PDB entry 4jfh

View 4jfh on RCSB PDB site
Description: High Affinity alpha24-beta17 T Cell Receptor for A2 HLA-Melanoma peptide complex
Class: Immune System
Keywords: Immunoglobulin, HLA, TCR, Melanoma, Immune System, High Affinity
Deposited on 2013-02-28, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: alpha24 TCR allele
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JFH (0-199)
    Domains in SCOPe 2.07: d4jfhd1, d4jfhd2
  • Chain 'E':
    Compound: beta17 TCR allele
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JFH (0-243)
    Domains in SCOPe 2.07: d4jfhe1, d4jfhe2
  • Heterogens: EDO, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jfhD (D:)
    qkeveqnsgplsvpegaiaslnctysflgsqsffwyrqysgkspelimftyregdkedgr
    ftaqlnkasqhvsllirdsqpsdsatylcavndggrltfgdgttltvkpniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpsp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jfhE (E:)
    sqtihqwpatlvqpvgsplslectvegtsnpnlywyrqaagrgpqllfywgpfgqissev
    pqnlsasrpqdrqfilsskklllsdsgfylcawsetglgmggwqfgegsrltvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad