PDB entry 4jeg

View 4jeg on RCSB PDB site
Description: Crystal Structure of Monobody CS1/SHP2 C-SH2 Domain Complex
Class: Signaling protein/protein binding
Keywords: engineered binding protein, SHP2 SH2-monobody complex, Phosphatase, Phosphotyrosine Binding, Phosphorylation, Signaling protein-protein binding complex
Deposited on 2013-02-26, released 2013-08-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein phosphatase non-receptor type 11
  Species: Homo sapiens [TaxId:9606]
  Gene: PTP2C, PTPN11, SHPTP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q06124 (Start-120)
    • expression tag (121-122)
  Domains in SCOPe 2.06: d4jega1, d4jega2
• Chain 'B':
  Compound: Monobody CS1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4JEG (Start-93)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4jegA (A:)
  elkyplncadptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgdd
  kgesndgkskvthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqpl
  nkek
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4jegA (A:)
  lncadptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkdgks
  kvthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnke
  

  
  
• Chain 'B':
  No sequence available.