PDB entry 4jeg

View 4jeg on RCSB PDB site
Description: Crystal Structure of Monobody CS1/SHP2 C-SH2 Domain Complex
Class: Signaling protein/protein binding
Keywords: engineered binding protein, SHP2 SH2-monobody complex, Phosphatase, Phosphotyrosine Binding, Phosphorylation, Signaling protein-protein binding complex
Deposited on 2013-02-26, released 2013-08-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTP2C, PTPN11, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124 (Start-120)
      • expression tag (121-122)
    Domains in SCOPe 2.05: d4jega_
  • Chain 'B':
    Compound: Monobody CS1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JEG (Start-93)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jegA (A:)
    elkyplncadptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgdd
    kgesndgkskvthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqpl
    nkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jegA (A:)
    lncadptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkdgks
    kvthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnke
    

  • Chain 'B':
    No sequence available.