PDB entry 4je2

View 4je2 on RCSB PDB site
Description: Structure of a Dihydroxycoumarin Active-Site Inhibitor in Complex with the RNase H Domain of HIV-1 Reverse Transcriptase
Class: HYDROLASE/Hydrolase Inhibitor
Keywords: RNase H Inhibitor, structure-based drug design, active site, dihydroxycoumarin analogs, dihydroxy-benzopyrone derivatives, divalent cation chelator, AIDS, Reverse transcriptase, Protein-inhibitor complex, HYDROLASE-Hydrolase Inhibitor complex
Deposited on 2013-02-26, released 2014-03-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNase H
  Species: Human immunodeficiency virus type 1 [TaxId:11678]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-132)
  Domains in SCOPe 2.08: d4je2a_
• Chain 'B':
  Compound: RNase H
  Species: Human immunodeficiency virus type 1 [TaxId:11678]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-132)
  Domains in SCOPe 2.08: d4je2b_
• Heterogens: F95, MN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4je2A (A:)
  lwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiyl
  alqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgigg
  neqvdklvsagir
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4je2B (B:)
  lwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiyl
  alqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgigg
  neqvdklvsagir