PDB entry 4jdc

View 4jdc on RCSB PDB site
Description: Crystal structure of the Delta-pyrroline-5-carboxylate dehydrogenase from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: pyrroline-5-carboxylate dehydrogenase, Aldehyde dehydrogenase, oxydoreduction, OXIDOREDUCTASE
Deposited on 2013-02-24, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: RVBD_1187
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6X0K4 (20-562)
      • engineered mutation (524)
    Domains in SCOPe 2.07: d4jdca_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jdcA (A:)
    mgsshhhhhhssglvprgshmdaitqvpvpanepvhdyapkspertrlrtelasladhpi
    dlphviggrhrmgdgeridvvqphrhaarlgtltnathadaaaaveaamsaksdwaalpf
    deraavflraadllagpwrekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqil
    eqqpisgpgewnridyrpldgfvyaitpfnftsiagnlptapalmgntviwkpsitqtla
    ayltmqlleaaglppgvinlvtgdgfavsdvaladprlagihftgstatfghlwqwvgtn
    igryhsyprlvgetggkdfvvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvw
    qrmgdellakaaelrygditdlsnyggalidqrafvknvdaierakgaaavtvavggeyd
    dsegyfvrptvllsddptdesfvieyfgpllsvhvypderyeqildvidtgsryaltgav
    iaddrqavltaldrlrfaagnfyvndkptgavvgrqpfggargsdtndkagsplnllrwt
    sarsiketfvaatdhiyphmavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jdcA (A:)
    mdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgeridv
    vqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwre
    kiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpld
    gfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvinl
    vtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdfv
    vahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdit
    dlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptyf
    gpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaagnfyvndk
    ptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyphmavd