PDB entry 4jco

View 4jco on RCSB PDB site
Description: 1.7 A resolution structure of wild type malate dehydrogenase from haloarcula marismortui
Class: oxidoreductase
Keywords: halophile, oxidoreductase, malate dehydrogenase tricarboxylic acid cycle
Deposited on 2013-02-22, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.226
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Gene: mdh, rrnAC2706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcoa1, d4jcoa2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Gene: mdh, rrnAC2706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcob1, d4jcob2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Gene: mdh, rrnAC2706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcoc1, d4jcoc2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Gene: mdh, rrnAC2706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcod1, d4jcod2
  • Heterogens: CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jcoA (A:)
    mtkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntr
    vrqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyisltts
    npvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaq
    vpvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhd
    tgevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqy
    dkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcoA (A:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jcoB (B:)
    mtkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntr
    vrqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyisltts
    npvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaq
    vpvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhd
    tgevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqy
    dkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcoB (B:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jcoC (C:)
    mtkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntr
    vrqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyisltts
    npvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaq
    vpvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhd
    tgevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqy
    dkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcoC (C:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jcoD (D:)
    mtkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntr
    vrqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyisltts
    npvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaq
    vpvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhd
    tgevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqy
    dkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcoD (D:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis