PDB entry 4jcl

View 4jcl on RCSB PDB site
Description: Crystal structure of Alpha-CGT from Paenibacillus macerans at 1.7 Angstrom resolution
Class: transferase
Keywords: alpha beta barrel, calcium binding, alpha cyclodextrin glycosyltransferase, transferase
Deposited on 2013-02-22, released 2014-02-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.166
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrin glucanotransferase
    Species: Paenibacillus macerans [TaxId:44252]
    Gene: cgtM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jcla1, d4jcla2, d4jcla3, d4jcla4
  • Heterogens: CA, CL, GOL, EDO, PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jclA (A:)
    spdtsvdnkvnfstdviyqivtdrfadgdrtnnpagdafsgdrsnlklyfggdwqgiidk
    indgyltgmgvtalwisqpvenitsvikysgvnntsyhgywardfkqtndafgdfadfqn
    lidtahahnikvvidfapnhtspadrdnpgfaenggmydngsllgaysndtaglfhhngg
    tdfstiedgiyknlydladinhnnnamdayfksaidlwlgmgvdgirfdavkhmpfgwqk
    sfvssiyggdhpvftfgewylgadqtdgdnikfanesgmnlldfeyaqevrevfrdktet
    mkdlyevlastesqydyinnmvtfidnhdmdrfqvagsgtrateqalaltltsrgvpaiy
    ygteqymtgdgdpnnrammtsfntgttaykviqalaplrksnpaiaygttterwvnndvl
    iierkfgssaalvainrnssaaypisgllsslpagtysdvlngllngnsitvgsggavtn
    ftlaaggtavwqytapetspaignvgptmgqpgnivtidgrgfggtagtvyfgttavtgs
    givswedtqikavipkvaagktgvsvktssgtasntfksfnvltgdqvtvrflvnqantn
    ygtnvylvgnaaelgswdpnkaigpmynqviakypswyydvsvpagtkldfkfikkgggt
    vtwegggnhtyttpasgvgtvtvdwqn