PDB entry 4jcc

View 4jcc on RCSB PDB site
Description: Crystal structure of iron uptake ABC transporter substrate-binding protein PiuA from Streptococcus pneumoniae Canada MDR_19A
Class: transport protein
Keywords: center for structural genomics of infectious diseases, csgid, niaid, national institute of allergy and infectious diseases, alpha and beta protein, periplasmic binding protein type III fold, iron transport, iron uptake abc transport system substrate binding protein, transport protein, putative membrane-anchored lipoprotein
Deposited on 2013-02-21, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: 0.146
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-compound ABC transporter, iron-compound-binding protein
    Species: Streptococcus pneumoniae [TaxId:637987]
    Gene: MYY_1766
    Database cross-references and differences (RAF-indexed):
    • Uniprot H8LJX2 (1-End)
      • conflict (146)
    Domains in SCOPe 2.07: d4jcca_
  • Heterogens: CL, SO4, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jccA (A:)
    gsaptevtikssldevklskvpekivtfdlgaadtiralgfaknivgmptktvptylkdl
    vgtvknvgsmkepdleaiaalepdliiasprtqkfvdkfkeiaptvlfqaskddywtstk
    anieslasafgetgtqkakeelakldesiqevatknessdkkalaillnegkmaafgaks
    rfsflyqtlkfkptdtkfedsrhgqevsfesvkeinpdilfvinrtlaiggdnssndgvl
    enaliaetpaakngkiiqltpdlwylsggglestklmiediqkalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jccA (A:)
    saptevtikssldevklskvpekivtfdlgaadtiralgfaknivgmptktvptylkdlv
    gtvknvgsmkepdleaiaalepdliiasprtqkfvdkfkeiaptvlfqaskddywtstka
    nieslasafgetgtqkakeelakldesiqevatknessdkkalaillnegkmaafgaksr
    fsflyqtlkfkptdtkfedsrhgqevsfesvkeinpdilfvinrtlaiggdnssndgvle
    naliaetpaakngkiiqltpdlwylsggglestklmiediqkal