PDB entry 4jbs

View 4jbs on RCSB PDB site
Description: Crystal structure of the human Endoplasmic Reticulum Aminopeptidase 2 in complex with PHOSPHINIC PSEUDOTRIPEPTIDE inhibitor.
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Thermolysin-like catalytic domain, Hydrolase, Aminopeptidase, Zinc binding, Endoplasmic Reticulum, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2013-02-20, released 2013-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.21
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum aminopeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP2, LRAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P179 (Start-959)
      • expression tag (960)
    Domains in SCOPe 2.04: d4jbsa1, d4jbsa2, d4jbsa3, d4jbsa4
  • Chain 'B':
    Compound: Endoplasmic reticulum aminopeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP2, LRAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P179 (Start-959)
      • expression tag (960)
    Domains in SCOPe 2.04: d4jbsb1, d4jbsb2, d4jbsb3, d4jbsb4
  • Heterogens: NAG, ZN, P52, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jbsA (A:)
    mvhssamvnshrkpmfnihrgfycltailpqicicsqfsvpssyhftedpgafpvatnge
    rfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskdleitna
    tlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfy
    kstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvk
    tielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkrnqthyal
    qaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssasd
    klwvtrviahelahqwfgnlvtmewwndiwlkegfakymeliavnatypelqfddyflnv
    cfevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiq
    ylkkfsyrnaknddlwsslsnsclesdftsggvchsdpkmtsnmlaflgenaevkemmtt
    wtlqkgipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvi
    hrhilksktdtldlpektswvkfnvdsngyyivhyeghgwdqlitqlnqnhtllrpkdrv
    glihdvfqlvgagrltldkaldmtyylqhetsspalleglsylesfyhmmdrrnisdise
    nlkryllqyfkpvidrqswsdkgsvwdrmlrsallklacdlnhapciqkaaelfsqwmes
    sgklniptdvlkivysvgaqttagwnylleqyelsmssaeqnkilyalstskhqekllkl
    ielgmegkviktqnlaallhaiarrpkgqqlawdfvrenwthllkkfdlgsydirmiisg
    ttahfsskdklqevklffesleaqgshldifqtvletitknikwleknlptlrtwlmvnt
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jbsA (A:)
    pvatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhsk
    dleitnatlqseeymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgf
    egfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnm
    pkvktielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkrnqt
    hyalqaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpkts
    sasdklwvtrviahelahqwfgnlvtmewwndiwlkegfakymeliavnatypelqfddy
    flnvcfevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqk
    giiqylkkfsyrnaknddlwsslsnslgenaevkemmttwtlqkgipllvvkqdgcslrl
    qqerflqgqerylwhipltystsssnvihrhilksktdtldlpektswvkfnvdsngyyi
    vhyeghgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhets
    spalleglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrs
    allklacdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqy
    elsmssaeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqla
    wdfvrenwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifq
    tvletitknikwleknlptlrtwlmvntr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jbsB (B:)
    mvhssamvnshrkpmfnihrgfycltailpqicicsqfsvpssyhftedpgafpvatnge
    rfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskdleitna
    tlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfy
    kstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvk
    tielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkrnqthyal
    qaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssasd
    klwvtrviahelahqwfgnlvtmewwndiwlkegfakymeliavnatypelqfddyflnv
    cfevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiq
    ylkkfsyrnaknddlwsslsnsclesdftsggvchsdpkmtsnmlaflgenaevkemmtt
    wtlqkgipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvi
    hrhilksktdtldlpektswvkfnvdsngyyivhyeghgwdqlitqlnqnhtllrpkdrv
    glihdvfqlvgagrltldkaldmtyylqhetsspalleglsylesfyhmmdrrnisdise
    nlkryllqyfkpvidrqswsdkgsvwdrmlrsallklacdlnhapciqkaaelfsqwmes
    sgklniptdvlkivysvgaqttagwnylleqyelsmssaeqnkilyalstskhqekllkl
    ielgmegkviktqnlaallhaiarrpkgqqlawdfvrenwthllkkfdlgsydirmiisg
    ttahfsskdklqevklffesleaqgshldifqtvletitknikwleknlptlrtwlmvnt
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jbsB (B:)
    vatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskd
    leitnatlqsepgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfyk
    styrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvkt
    ielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkrnqthyalq
    aslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssasdk
    lwvtrviahelahqwfgnlvtmewwndiwlkegfakymeliavnatypelqfddyflnvc
    fevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiqy
    lkkfsyrnaknddlwsslsnsaevkemmttwtlqkgiplldgcslrlqqerflqgveryl
    whiplttsssnvihrhilksktdtldlpektswvkfnvdsngyyivhyeghgwdqlitql
    nqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspalleglsylesfy
    hmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallklacdlnhapci
    qkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsmssaeqnkilya
    lstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvrenwthllkkf
    dlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvletitknikwlek
    nlptlrtwlmvntr