PDB entry 4jbp

View 4jbp on RCSB PDB site
Description: Novel Aurora kinase inhibitors reveal mechanisms of HURP in nucleation of centrosomal and kinetochore microtubules
Class: transferase
Keywords: Aurora Kinase inhibitors, HURP, mitotic spindle, TRANSFERASE
Deposited on 2013-02-20, released 2013-06-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.226
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4jbpa_
  • Heterogens: YPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jbpA (A:)
    skkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrev
    eiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelan
    alsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrtdlcgtldylppemie
    grmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisr
    llkhnpsqrpmlrevlehpwitansskpsncqnkesask
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jbpA (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhgtldylppemiegrmhdekvdlwsl
    gvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlr
    evlehpwitansskp