PDB entry 4jbe

View 4jbe on RCSB PDB site
Description: 1.95 Angstrom Crystal Structure of Gamma-glutamyl phosphate Reductase from Saccharomonospora viridis.
Class: oxidoreductase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, gamma-glutamyl phosphate reductase, NAD(P), OXIDOREDUCTASE
Deposited on 2013-02-19, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-glutamyl phosphate reductase
    Species: Saccharomonospora viridis [TaxId:471857]
    Gene: proA, Svir_28610
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jbea_
  • Chain 'B':
    Compound: Gamma-glutamyl phosphate reductase
    Species: Saccharomonospora viridis [TaxId:471857]
    Gene: proA, Svir_28610
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jbeb_
  • Heterogens: CA, CL, BME, EDO, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jbeA (A:)
    mhhhhhhssgvdlwshpqfekgtenlyfqsnamtnevakaveecaraaksaapslsgapd
    taidaalesmadrllahrdavlaanaediakaeaggmsaglldrltitesrltdmadqlr
    llagaphpqrtvelstldgglrlverrrpvgviganyearpnvtvdvasqlvksrnagvl
    rtgsaalksaqrllevvirpaltdsgidanvvqlvprpereaagalvrlpdlvplvilrg
    sgestralaleaaqhgvrtlahadgggvlyvdekadrdtvrslvvnsldrlgvcnrlnll
    lihdavyeefwpvvsealaergvspslppydhpigyewaldsereatvtvarvdgvaeav
    rianeetsglaagiatedaraaeeffdgyqgtgvfwnaptrlldgfkllgvpetginldk
    vpgprgpvtypdlyvrqyavlpver
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jbeA (A:)
    nevakaveecaraaksaapslsgapdtaidaalesmadrllahrdavlaanaediakaea
    ggmsaglldrltitesrltdmadqlrllagaphpqrtvelstldgglrlverrrpvgvig
    anyearpnvtvdvasqlvksrnagvlrtgsaalksaqrllevvirpaltdsgidanvvql
    vprpereaagalvrlpdlvplvilrgsgestralaleaaqhgvrtlahadgggvlyvdek
    adrdtvrslvvnsldrlgvcnrlnlllihdavyeefwpvvsealaergvspslppydhpi
    gyewaldsereatvtvarvdgvaeavrianeetsglaagiatedaraaeeffdgyqgtgv
    fwnaptrlldgfkllgvpetginldkvpgprgpvtypdlyvrqyavlpver
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jbeB (B:)
    mhhhhhhssgvdlwshpqfekgtenlyfqsnamtnevakaveecaraaksaapslsgapd
    taidaalesmadrllahrdavlaanaediakaeaggmsaglldrltitesrltdmadqlr
    llagaphpqrtvelstldgglrlverrrpvgviganyearpnvtvdvasqlvksrnagvl
    rtgsaalksaqrllevvirpaltdsgidanvvqlvprpereaagalvrlpdlvplvilrg
    sgestralaleaaqhgvrtlahadgggvlyvdekadrdtvrslvvnsldrlgvcnrlnll
    lihdavyeefwpvvsealaergvspslppydhpigyewaldsereatvtvarvdgvaeav
    rianeetsglaagiatedaraaeeffdgyqgtgvfwnaptrlldgfkllgvpetginldk
    vpgprgpvtypdlyvrqyavlpver
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jbeB (B:)
    tnevakaveecaraaksaapslsgapdtaidaalesmadrllahrdavlaanaediakae
    aggmsaglldrltitesrltdmadqlrllagaphpqrtvelstldgglrlverrrpvgvi
    ganyearpnvtvdvasqlvksrnagvlrtgsaalksaqrllevvirpaltdsgidanvvq
    lvprpereaagalvrlpdlvplvilrgsgestralaleaaqhgvrtlahadgggvlyvde
    kadrdtvrslvvnsldrlgvcnrlnlllihdavyeefwpvvsealaergvspslppydhp
    igyewaldsereatvtvarvdgvaeavrianeetsglaagiatedaraaeeffdgyqgtg
    vfwnaptrlldgfkllgvpetginldkvpgprgpvtypdlyvrqyavlpver