PDB entry 4jb9

View 4jb9 on RCSB PDB site
Description: Crystal structure of antibody VRC06 in complex with HIV-1 gp120 core
Class: viral protein/immune system
Keywords: HIV-1, gp120, antibody, VRC06, glycoprotein, IMMUNE SYSTEM, viral protein-immune system complex
Deposited on 2013-02-19, released 2013-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: clade A/E 93TH057 HIV-1 gp120 core
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JB9 (0-352)
  • Chain 'H':
    Compound: antibody VRC06 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JB9 (0-231)
  • Chain 'L':
    Compound: antibody VRC06 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JB9 (0-208)
    Domains in SCOPe 2.07: d4jb9l1, d4jb9l2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jb9L (L:)
    eivltqspatlslspgeratlscrasqggnslnwyqkrrgqtprlliydtsrrasdipek
    fvgsgsgtdfsltitkvgpedfavyycqqfeffglgttleinrtvaapsvfifppsdeql
    ksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskad
    yekhkvyacevthqglsspvtksfnrgec