PDB entry 4jas

View 4jas on RCSB PDB site
Description: Structural basis of a rationally rewired protein-protein interface (HK853mutant A268V, A271G, T275M, V294T and D297E and RR468mutant V13P, L14I, I17M and N21V)
Class: transferase/signaling protein
Keywords: Bergerat fold, alpha/beta domain, signal transduction, autophosphorylation, phosphotransferase, dephosphorylation, histidine kinase, response regulator, phosphorylation, TRANSFERASE-SIGNALING PROTEIN complex
Deposited on 2013-02-19, released 2013-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.212
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine kinase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM_0853
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZV7
      • engineered mutation (36)
      • engineered mutation (39)
      • engineered mutation (43)
      • engineered mutation (62)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d4jasa1, d4jasa2
  • Chain 'B':
    Compound: Response regulator
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM_0468
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYT9 (Start-121)
      • engineered mutation (12-13)
      • engineered mutation (16)
      • engineered mutation (20)
    Domains in SCOPe 2.07: d4jasb_
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jasA (A:)
    venvteskelerlkridrmktefianishelrtpltvikgyaemiynslgeldlstlkef
    letiieqsnhlenllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnv
    lfesnvpcpveayidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliived
    ngigipdhakdrifeqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgsr
    ffvwipkdragednrqdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jasA (A:)
    lkridrmktefianishelrtpltvikgyaemiynslgeldlstlkefletiieqsnhle
    nllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpvea
    yidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliivedngigipdhakdr
    ifeqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgsrffvwipkdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jasB (B:)
    mskkvllvddsapirkmvsfvlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    ne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jasB (B:)
    skkvllvddsapirkmvsfvlkkegyevieaengqialeklseftpdlivldimmpvmdg
    ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
    e