PDB entry 4jan

View 4jan on RCSB PDB site
Description: crystal structure of broadly neutralizing antibody CH103 in complex with HIV-1 gp120
Class: viral protein/immune system
Keywords: HIV-1, gp120, GLYCOPROTEIN, VIRAL PROTEIN-IMMUNE SYSTEM COMPLEX, Antibody, immunoglobulin, NEUTRALIZATION, VACCINE
Deposited on 2013-02-18, released 2013-04-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.199
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ANTIGEN BINDING FRAGMENT OF HEAVY CHAIN of CH103
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JAN (0-End)
  • Chain 'B':
    Compound: ANTIGEN BINDING FRAGMENT OF LIGHT CHAIN of CH103
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JAN (0-End)
    Domains in SCOPe 2.04: d4janb1, d4janb2
  • Chain 'G':
    Compound: ENVELOPE GLYCOPROTEIN GP120 of HIV-1 clade C
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JAN
  • Chain 'H':
    Compound: ANTIGEN BINDING FRAGMENT OF HEAVY CHAIN of CH103
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JAN (0-End)
  • Chain 'I':
    Compound: ENVELOPE GLYCOPROTEIN GP120 of HIV-1 clade C
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JAN
  • Chain 'L':
    Compound: ANTIGEN BINDING FRAGMENT OF LIGHT CHAIN of CH103
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JAN (0-End)
    Domains in SCOPe 2.04: d4janl1, d4janl2
  • Heterogens: NAG, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4janB (B:)
    yeltqppsvsvspgqtatitcsgastnvcwyqvkpgqspevvifenykrpsgipdrfsgs
    ksgstatltirgtqaideadyycqvwdsfstfvfgsgtqvtvlrqpkanptvtlfppsse
    elqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpe
    qwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4janB (B:)
    yeltqppsvsvspgqtatitcsgastnvcwyqvkpgqspevvifenykrpsgipdrfsgs
    ksgstatltirgtqaideadyycqvwdsfstfvfgsgtqvtvlrqpkanptvtlfppsse
    elqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpe
    qwkshrsyscqvthegstvektvapt
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4janL (L:)
    yeltqppsvsvspgqtatitcsgastnvcwyqvkpgqspevvifenykrpsgipdrfsgs
    ksgstatltirgtqaideadyycqvwdsfstfvfgsgtqvtvlrqpkanptvtlfppsse
    elqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpe
    qwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4janL (L:)
    yeltqppsvsvspgqtatitcsgastnvcwyqvkpgqspevvifenykrpsgipdrfsgs
    ksgstatltirgtqaideadyycqvwdsfstfvfgsgtqvtvlrqpkanptvtlfppsse
    elqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpe
    qwkshrsyscqvthegstvektvapt