PDB entry 4jam

View 4jam on RCSB PDB site
Description: Crystal structure of broadly neutralizing anti-hiv-1 antibody ch103
Class: immune system
Keywords: NEUTRALIZATION, VACCINE, HIV-1, Antibody, immunoglobulin, IMMUNE SYSTEM
Deposited on 2013-02-18, released 2013-04-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.17
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ANTIGEN BINDING FRAGMENT OF HEAVY CHAIN of CH103
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JAM
  • Chain 'B':
    Compound: ANTIGEN BINDING FRAGMENT OF LIGHT CHAIN of CH103
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JAM
    Domains in SCOPe 2.04: d4jamb1, d4jamb2
  • Chain 'H':
    Compound: ANTIGEN BINDING FRAGMENT OF HEAVY CHAIN of CH103
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JAM (0-End)
  • Chain 'L':
    Compound: ANTIGEN BINDING FRAGMENT OF LIGHT CHAIN of CH103
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JAM (0-End)
    Domains in SCOPe 2.04: d4jaml1, d4jaml2
  • Heterogens: SO4, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jamB (B:)
    yeltqppsvsvspgqtatitcsgastnvcwyqvkpgqspevvifenykrpsgipdrfsgs
    ksgstatltirgtqaideadyycqvwdsfstfvfgsgtqvtvlrqpkanptvtlfppsse
    elqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpe
    qwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jamB (B:)
    eltqppsvsvspgqtatitcsgastnvcwyqvkpgqspevvifenykrpsgipdrfsgsk
    sgstatltirgtqaideadyycqvwdsfstfvfgsgtqvtvlrqpkanptvtlfppssee
    lqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpeq
    wkshrsyscqvthegstvektvapt
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jamL (L:)
    yeltqppsvsvspgqtatitcsgastnvcwyqvkpgqspevvifenykrpsgipdrfsgs
    ksgstatltirgtqaideadyycqvwdsfstfvfgsgtqvtvlrqpkanptvtlfppsse
    elqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpe
    qwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jamL (L:)
    yeltqppsvsvspgqtatitcsgastnvcwyqvkpgqspevvifenykrpsgipdrfsgs
    ksgstatltirgtqaideadyycqvwdsfstfvfgsgtqvtvlrqpkanptvtlfppsse
    elqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpe
    qwkshrsyscqvthegstvektvapt