PDB entry 4j9i

View 4j9i on RCSB PDB site
Description: Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P17
Class: Transferase/unknown function
Keywords: beta shandwich, SH3 domain, kinase, poly proline rich motifs, Transferase-unknown function complex
Deposited on 2013-02-16, released 2014-01-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL, ABL1, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j9ia_
  • Chain 'B':
    Compound: p17
    Database cross-references and differences (RAF-indexed):
    • PDB 4J9I (Start-9)
  • Chain 'C':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL, ABL1, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j9ic_
  • Chain 'D':
    Compound: p17
    Database cross-references and differences (RAF-indexed):
    • PDB 4J9I (Start-9)
  • Chain 'E':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL, ABL1, JTK7
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: p17
    Database cross-references and differences (RAF-indexed):
    • PDB 4J9I (Start-9)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4j9iA (A:)
mendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitp
vns

    Sequence, based on observed residues (ATOM records): (download) 
    >4j9iA (A:)
lfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4j9iC (C:)
mendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitp
vns

    Sequence, based on observed residues (ATOM records): (download) 
    >4j9iC (C:)
lfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.