PDB entry 4j97

View 4j97 on RCSB PDB site
Description: Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic Gain-of-Function K659E Mutation Identified in Endometrial Cancer.
Class: transferase
Keywords: Kinase Domain Fold Consisting of N- and C-lobes, Receptor Tyrosine Kinase, ATP Binding, TRANSFERASE
Deposited on 2013-02-15, released 2013-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BEK, FGFR2, KGFR, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered mutation (214)
    Domains in SCOPe 2.07: d4j97a_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BEK, FGFR2, KGFR, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered mutation (214)
    Domains in SCOPe 2.07: d4j97b_
  • Chain 'C':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BEK, FGFR2, KGFR, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered mutation (214)
    Domains in SCOPe 2.07: d4j97c_
  • Chain 'D':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BEK, FGFR2, KGFR, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered mutation (214)
    Domains in SCOPe 2.07: d4j97d_
  • Heterogens: ACP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j97A (A:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyykettngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j97A (A:)
    lpedpkwefprdkltlgkplgegqvvmaeavgidkpkeavtvavkmlkddatekdlsdlv
    sememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgpeeqmtfkd
    lvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyykettn
    grlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeghrm
    dkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j97B (B:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyykettngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j97B (B:)
    lpedpkwefprdkltlgkplgegqvvmaeavgideavtvavkmlkddatekdlsdlvsem
    emmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppginrvpeeqmtfk
    dlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyykett
    ngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeghr
    mdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4j97C (C:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyykettngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j97C (C:)
    elpedpkwefprdkltlgkplgfgqvvmaeavgideavtvavkmlkddatekdlsdlvse
    memmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppinrvpeeqmtfk
    dlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyykett
    ngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeghr
    mdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4j97D (D:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyykettngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j97D (D:)
    yelpedpkwefprdkltlgkplgqvvmaeavgidkdkpkeavtvavkmlkddatekdlsd
    lvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrpprvpeeqmt
    fkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyyke
    ttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeg
    hrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt