PDB entry 4j96

View 4j96 on RCSB PDB site
Description: Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic Gain-of-Function K659M Mutation Identified in Cervical Cancer.
Class: transferase
Keywords: Kinase Domain Fold Consisting of N- and C-lobes, Receptor Tyrosine Kinase, ATP Binding, TRANSFERASE
Deposited on 2013-02-15, released 2013-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BEK, FGFR2, KGFR, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered mutation (46)
      • engineered mutation (214)
    Domains in SCOPe 2.07: d4j96a_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BEK, FGFR2, KGFR, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered mutation (46)
      • engineered mutation (214)
    Domains in SCOPe 2.07: d4j96b_
  • Heterogens: SO4, FLC, ACP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j96A (A:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyykmttngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j96A (A:)
    agvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlk
    ddatekdlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarr
    ppsydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiad
    fglardinnidyykmttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspy
    pgipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    tn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j96B (B:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyykmttngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j96B (B:)
    gvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkd
    datekdlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrp
    pgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmk
    iadfglardinnidyykmttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlgg
    spypgipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldril
    tlttn