PDB entry 4j7a

View 4j7a on RCSB PDB site
Description: Crystal Structure of Est25 - a Bacterial Homolog of Hormone-Sensitive Lipase from a Metagenomic Library
Class: hydrolase
Keywords: alpha/beta, Hydrolase
Deposited on 2013-02-13, released 2014-01-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.145
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j7aa_
  • Chain 'B':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j7ab_
  • Chain 'C':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j7ac_
  • Chain 'D':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j7ad_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j7aA (A:)
    mrgshhhhhhgsmsnatlnqlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppv
    nansevadciaystaaeqawqtlfamlgsqgepsnpvdvreetikgrggneiklyihspt
    ghtsdsdplpcvvhthgggmviltaadanysrwrselaatglvvvgvefrnaagalgnhp
    fpaglhdcadaakwvasnrealgistlimsgesgggnlslattmlakkegwleeiagvya
    qcpyisglyaskpeelpsllendayfldmktmgamvkpydptgenasnplawpyhasled
    laglpphvisvneldplrdeglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyf
    atvrdisafaysra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j7aA (A:)
    qlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqa
    wqtlfamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthggg
    mviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnr
    ealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsl
    lendayfldmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrd
    eglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j7aB (B:)
    mrgshhhhhhgsmsnatlnqlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppv
    nansevadciaystaaeqawqtlfamlgsqgepsnpvdvreetikgrggneiklyihspt
    ghtsdsdplpcvvhthgggmviltaadanysrwrselaatglvvvgvefrnaagalgnhp
    fpaglhdcadaakwvasnrealgistlimsgesgggnlslattmlakkegwleeiagvya
    qcpyisglyaskpeelpsllendayfldmktmgamvkpydptgenasnplawpyhasled
    laglpphvisvneldplrdeglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyf
    atvrdisafaysra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j7aB (B:)
    qlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqa
    wqtlfamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthggg
    mviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnr
    ealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsl
    lendayfldmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrd
    eglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4j7aC (C:)
    mrgshhhhhhgsmsnatlnqlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppv
    nansevadciaystaaeqawqtlfamlgsqgepsnpvdvreetikgrggneiklyihspt
    ghtsdsdplpcvvhthgggmviltaadanysrwrselaatglvvvgvefrnaagalgnhp
    fpaglhdcadaakwvasnrealgistlimsgesgggnlslattmlakkegwleeiagvya
    qcpyisglyaskpeelpsllendayfldmktmgamvkpydptgenasnplawpyhasled
    laglpphvisvneldplrdeglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyf
    atvrdisafaysra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j7aC (C:)
    qlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqa
    wqtlfamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthggg
    mviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnr
    ealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsl
    lendayfldmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrd
    eglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4j7aD (D:)
    mrgshhhhhhgsmsnatlnqlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppv
    nansevadciaystaaeqawqtlfamlgsqgepsnpvdvreetikgrggneiklyihspt
    ghtsdsdplpcvvhthgggmviltaadanysrwrselaatglvvvgvefrnaagalgnhp
    fpaglhdcadaakwvasnrealgistlimsgesgggnlslattmlakkegwleeiagvya
    qcpyisglyaskpeelpsllendayfldmktmgamvkpydptgenasnplawpyhasled
    laglpphvisvneldplrdeglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyf
    atvrdisafaysra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j7aD (D:)
    qlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqa
    wqtlfamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthggg
    mviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnr
    ealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsl
    lendayfldmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrd
    eglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra