PDB entry 4j70

View 4j70 on RCSB PDB site
Description: Yeast 20S proteasome in complex with the belactosin derivative 3e
Class: hydrolase/hydrolase inhibitor
Keywords: Proteasome, drug discovery, irreversible inhibition, beta-lactone, Ntn hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-02-12, released 2013-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.175
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70a_
  • Chain 'B':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70b_
  • Chain 'C':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70c_
  • Chain 'D':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70d_
  • Chain 'E':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70e_
  • Chain 'F':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70f_
  • Chain 'G':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70g_
  • Chain 'H':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70h_
  • Chain 'I':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70i_
  • Chain 'J':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70j_
  • Chain 'K':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70k_
  • Chain 'L':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70l_
  • Chain 'M':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70m_
  • Chain 'N':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70n_
  • Chain 'O':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70o_
  • Chain 'P':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70p_
  • Chain 'Q':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70q_
  • Chain 'R':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70r_
  • Chain 'S':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70s_
  • Chain 'T':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70t_
  • Chain 'U':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70u_
  • Chain 'V':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70v_
  • Chain 'W':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70w_
  • Chain 'X':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70x_
  • Chain 'Y':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70y_
  • Chain 'Z':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j70z_
  • Chain 'a':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 1KR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j70A (A:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j70B (B:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgitkkdedeeadedmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70B (B:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4j70C (C:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70C (C:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4j70D (D:)
    mfltrseydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratsplle
    sdsiekiveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdla
    lrfgegasgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaq
    aellnewhssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaeli
    kelkekeaaespeeadvems
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70D (D:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
    geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
    ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
    ae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4j70E (E:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70E (E:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4j70F (F:)
    mtsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllv
    pqknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyv
    qahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklv
    dhhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeai
    dfaqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70F (F:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4j70G (G:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70G (G:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4j70H (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70H (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4j70I (I:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70I (I:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j70J (J:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j70K (K:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j70L (L:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j70M (M:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j70N (N:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j70O (O:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4j70P (P:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgitkkdedeeadedmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70P (P:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4j70Q (Q:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70Q (Q:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4j70R (R:)
    mfltrseydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratsplle
    sdsiekiveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdla
    lrfgegasgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaq
    aellnewhssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaeli
    kelkekeaaespeeadvems
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70R (R:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
    geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
    ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
    ae
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4j70S (S:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70S (S:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4j70T (T:)
    mtsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllv
    pqknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyv
    qahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklv
    dhhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeai
    dfaqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70T (T:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4j70U (U:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70U (U:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4j70V (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70V (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4j70W (W:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j70W (W:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j70X (X:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j70Y (Y:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j70Z (Z:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.