PDB entry 4j6t

View 4j6t on RCSB PDB site
Description: Crystal Structure of Tyrosinase from Bacillus megaterium F197A mutant
Class: oxidoreductase
Keywords: type 3 copper proteins, OXIDOREDUCTASE
Deposited on 2013-02-12, released 2013-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2ZB02
      • engineered mutation (196)
    Domains in SCOPe 2.07: d4j6ta_
  • Chain 'B':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2ZB02
      • engineered mutation (196)
    Domains in SCOPe 2.07: d4j6tb_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j6tA (A:)
    mgnkyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaah
    mssaflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnp
    ikdfivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtp
    pwdmtsqnsfrnqlegaingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwav
    wqiihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydielrkskrsshhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j6tA (A:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegaingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j6tB (B:)
    mgnkyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaah
    mssaflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnp
    ikdfivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtp
    pwdmtsqnsfrnqlegaingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwav
    wqiihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydielrkskrsshhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j6tB (B:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegaingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydie