PDB entry 4j6i

View 4j6i on RCSB PDB site
Description: Discovery of thiazolobenzoxepin PI3-kinase inhibitors that spare the PI3-kinase beta isoform
Class: Transferase/Transferase Inhibitor
Keywords: beta-sparing, SBDD, catalytic subunit gamma, phosphorylation, Transferase-Transferase Inhibitor complex
Deposited on 2013-02-11, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: p110 gamma, PIK3CG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4j6ia1, d4j6ia2, d4j6ia3, d4j6ia4, d4j6ia5
  • Heterogens: 1JV

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j6iA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j6iA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsffteqdfvlrvcgrd
    eylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeecdrkfrvkirgidipv
    lprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlq
    iycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisilldnh
    piaempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqe
    ivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllq
    lvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylr
    gcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpes
    frvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdm
    lilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgaf
    kdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfh
    idfghiervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmm
    lmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwf