PDB entry 4j6g

View 4j6g on RCSB PDB site
Description: CRYSTAL STRUCTURE OF LIGHT AND DcR3 COMPLEX
Class: immune system
Keywords: LIGHT, DCR3, TNF, TNFR, TNF14, STRUCTURAL GENOMICS, PSI-BIOLOGY, NEW HVEM, N-GLYCOSYLATION, MEMBRANE, SECRETED PROTEIN, CYTOKINE, IFN, JELLY-ROLL FOLD, BIND TNF RECEPTOR HVEM AND LTBR, LTBR, Protein Structure Initiative, Atoms-to-Animals: The Immune Function Network, New York Structural Genomics Research Consortium, NYSGRC, IMMUNE SYSTEM
Deposited on 2013-02-11, released 2013-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-164)
      • engineered mutation (138)
    Domains in SCOPe 2.06: d4j6ga_
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-164)
      • engineered mutation (138)
    Domains in SCOPe 2.06: d4j6gb_
  • Chain 'C':
    Compound: Tumor necrosis factor receptor superfamily member 6B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF6B, DCR3, TR6, UNQ186/PRO212
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Tumor necrosis factor receptor superfamily member 6B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF6B, DCR3, TR6, UNQ186/PRO212
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, MG, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j6gA (A:)
    hhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvv
    tkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratsssr
    vwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j6gA (A:)
    vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
    vgcastithglykrtprypeelellvsqqspcgrvwwdssflggvvhleageevvvrvld
    erlvrlrdgtrsyfgafmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j6gB (B:)
    hhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvv
    tkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratsssr
    vwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j6gB (B:)
    vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
    vgcastithglykrtprypeelellvsqqspcgrvwwdssflggvvhleageevvvrvld
    erlvrlrdgtrsyfgafmv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.