PDB entry 4j5x

View 4j5x on RCSB PDB site
Description: Crystal Structure of the SR12813-bound PXR/RXRalpha LBD Heterotetramer Complex
Class: Retinoic acid-binding protein
Keywords: Pregnane X Receptor, Retinoid X Receptor alpha, Ligand binding domain, nuclear receptor, SR12813, alpha helical sandwich, unique intermolecular beta-sheet dimerization, xenobiotic sensing, upregulation of drug metabolism enzymes, Retinoic acid-binding protein
Deposited on 2013-02-10, released 2013-08-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.248
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 1 group I member 2, Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1I2, PXR, BHLHE74, NCOA1, SRC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nuclear receptor subfamily 1 group I member 2, Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1I2, PXR, BHLHE74, NCOA1, SRC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Retinoic acid receptor RXR-alpha, Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR2B1, RXRA, BHLHE74, NCOA1, SRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j5xc_
  • Chain 'D':
    Compound: Retinoic acid receptor RXR-alpha, Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR2B1, RXRA, BHLHE74, NCOA1, SRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j5xd_
  • Heterogens: SRL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4j5xC (C:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmtggsg
    gsshsslterhkilhrllqegsps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j5xC (C:)
    edmpverileaelavepktetyveanmglpndpvtnicqaadkqlftlvewakriphfse
    lplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvlt
    elvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeq
    pgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaprhkilhrllqe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4j5xD (D:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmtggsg
    gsshsslterhkilhrllqegsps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j5xD (D:)
    edmpverileaelavepktetyveanmglnpndpvtnicqaadkqlftlvewakriphfs
    elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
    telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
    qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaprhkilhrllqe