PDB entry 4j5w

View 4j5w on RCSB PDB site
Description: Crystal Structure of the apo-PXR/RXRalpha LBD Heterotetramer Complex
Class: Retinoic acid-binding protein
Keywords: Pregnane X Receptor, Retinoid X Receptor alpha, Ligand binding domain, nuclear receptor, alpha helical sandwich, unique intermolecular beta-sheet dimerization, xenobiotic sensing, upregulation of drug metabolism enzymes, Retinoic acid-binding protein
Deposited on 2013-02-10, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 1 group I member 2, Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BHLHE74, NCOA1, NR1I2, PXR, SRC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nuclear receptor subfamily 1 group I member 2, Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BHLHE74, NCOA1, NR1I2, PXR, SRC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Retinoic acid receptor RXR-alpha, Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BHLHE74, NCOA1, NR2B1, RXRA, SRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j5wc1
  • Chain 'D':
    Compound: Retinoic acid receptor RXR-alpha, Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BHLHE74, NCOA1, NR2B1, RXRA, SRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j5wd_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4j5wC (C:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmtggsg
    gsshsslterhkilhrllqegsps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j5wC (C:)
    nedmpverileaelavepkpndpvtnicqaadkqlftlvewakriphfselplddqvill
    ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq
    mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr
    lpalrsiglkclehlfffkligdtpidtflmemleahkilhrllqe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4j5wD (D:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmtggsg
    gsshsslterhkilhrllqegsps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j5wD (D:)
    nedmpverileaelavepkpndpvtnicqaadkqlftlvewakriphfselplddqvill
    ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq
    mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr
    lpalrsiglkclehlfffkligdtpidtflmemlearhkilhrllqe