PDB entry 4j57

View 4j57 on RCSB PDB site
Description: Structure of Plasmodium falciparum thioredoxin reductase-thioredoxin complex
Class: oxidoreductase
Keywords: Protein-Protein Complex, Thioredoxin fold, Oxidoreductase, Disulfide reductase, FAD binding, NADPH binding, Thioredoxin binding
Deposited on 2013-02-08, released 2013-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin reductase 2
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: trxr2, PFI1170c
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Thioredoxin reductase 2
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: trxr2, PFI1170c
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KQL8 (11-113)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d4j57e_
  • Chain 'F':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KQL8 (11-113)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d4j57f_
  • Heterogens: FAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4j57E (E:)
    rgshhhhhhgsvkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkm
    vfikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j57E (E:)
    vkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvdevs
    evtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4j57F (F:)
    rgshhhhhhgsvkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkm
    vfikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j57F (F:)
    vkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvdevs
    evtekenitsmptfkvykngssvdtllgandsalkqliekyaa