PDB entry 4j56

View 4j56 on RCSB PDB site
Description: Structure of Plasmodium falciparum thioredoxin reductase-thioredoxin complex
Class: oxidoreductase
Keywords: Protein-Protein Complex, Thioredoxin fold, Oxidoreductase, Disulfide reductase, FAD binding, NADPH binding, Thioredoxin binding
Deposited on 2013-02-08, released 2013-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.238
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin reductase 2
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: trxr2, PFI1170c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61076 (Start-540)
      • engineered mutation (534)
  • Chain 'B':
    Compound: Thioredoxin reductase 2
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: trxr2, PFI1170c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61076 (Start-540)
      • engineered mutation (534)
  • Chain 'C':
    Compound: Thioredoxin reductase 2
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: trxr2, PFI1170c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61076 (Start-540)
      • engineered mutation (534)
  • Chain 'D':
    Compound: Thioredoxin reductase 2
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: trxr2, PFI1170c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61076 (Start-540)
      • engineered mutation (534)
  • Chain 'E':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KQL8 (11-113)
      • expression tag (9-10)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d4j56e1, d4j56e2
  • Chain 'F':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KQL8 (11-113)
      • expression tag (9-10)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d4j56f1, d4j56f2
  • Chain 'G':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KQL8 (11-113)
      • expression tag (9-10)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d4j56g1, d4j56g2
  • Chain 'H':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KQL8 (11-113)
      • expression tag (9-10)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d4j56h1, d4j56h2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4j56E (E:)
    rgshhhhhhgsvkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkm
    vfikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j56E (E:)
    gsvkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvde
    vsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4j56F (F:)
    rgshhhhhhgsvkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkm
    vfikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j56F (F:)
    gsvkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvde
    vsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4j56G (G:)
    rgshhhhhhgsvkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkm
    vfikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j56G (G:)
    gsvkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvde
    vsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4j56H (H:)
    rgshhhhhhgsvkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkm
    vfikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j56H (H:)
    gsvkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvde
    vsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa