PDB entry 4j4p

View 4j4p on RCSB PDB site
Description: The complex of human IgE-Fc with two bound Fab fragments
Class: immune system
Keywords: Ig like domain, IMMUNE SYSTEM
Deposited on 2013-02-07, released 2014-03-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.239
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854
      • engineered mutation (41)
      • engineered mutation (147)
  • Chain 'B':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854
      • engineered mutation (41)
      • engineered mutation (147)
  • Chain 'C':
    Compound: Immunoglobulin G Fab Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J4P
  • Chain 'D':
    Compound: Immunoglobulin G Fab Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J4P
    Domains in SCOPe 2.04: d4j4pd1, d4j4pd2
  • Chain 'H':
    Compound: Immunoglobulin G Fab Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J4P (Start-248)
  • Chain 'L':
    Compound: Immunoglobulin G Fab Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J4P
    Domains in SCOPe 2.04: d4j4pl1, d4j4pl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4j4pD (D:)
    mdwspllltllahctgswaqsvltqppsasgtpgqrvtiscsgsssnignngvnwyqqvp
    gkppklliyyddllpsgvsdrfsgsksgtsaslaisglqsedeadyyceawddsldgvvf
    gggtkltvlgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvka
    gvetttpskqsnnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j4pD (D:)
    aqsvltqppsasgtpgqrvtiscsgsssnignngvnwyqqvpgkppklliyyddllpsgv
    sdrfsgsksgtsaslaisglqsedeadyyceawddsldgvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4j4pL (L:)
    mdwspllltllahctgswaqsvltqppsasgtpgqrvtiscsgsssnignngvnwyqqvp
    gkppklliyyddllpsgvsdrfsgsksgtsaslaisglqsedeadyyceawddsldgvvf
    gggtkltvlgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvka
    gvetttpskqsnnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j4pL (L:)
    aqsvltqppsasgtpgqrvtiscsgsssnignngvnwyqqvpgkppklliyyddllpsgv
    sdrfsgsksgtsaslaisglqsedeadyyceawddsldgvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapte