PDB entry 4j20
View 4j20 on RCSB PDB site
Description: X-ray structure of the cytochrome c-554 from chlorobaculum tepidum
Class: oxidoreductase
Keywords: Cytocrome c, electron transfer, Cytochrome Cz, OXIDOREDUCTASE
Deposited on
2013-02-04, released
2013-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated
2013-11-27, with a file datestamp of
2013-11-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.151
AEROSPACI score: 0.69
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cytochrome c-555
Species: Chlorobium tepidum [TaxId:194439]
Gene: CT0075
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KG93 (0-87)
- engineered mutation (0-1)
Domains in SCOPe 2.05: d4j20a_ - Chain 'B':
Compound: Cytochrome c-555
Species: Chlorobium tepidum [TaxId:194439]
Gene: CT0075
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KG93 (0-87)
- engineered mutation (0-1)
Domains in SCOPe 2.05: d4j20b_ - Heterogens: SO4, IPA, NA, HEB, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4j20A (A:)
stydaaagkatydascatchktgmmgapkvgdkaawapriaqgmntlvsksikgykgtkg
mmpakggnakltdaqvgnavaymvgqsk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4j20B (B:)
stydaaagkatydascatchktgmmgapkvgdkaawapriaqgmntlvsksikgykgtkg
mmpakggnakltdaqvgnavaymvgqsk