PDB entry 4j20

View 4j20 on RCSB PDB site
Description: X-ray structure of the cytochrome c-554 from chlorobaculum tepidum
Class: oxidoreductase
Keywords: Cytocrome c, electron transfer, Cytochrome Cz, OXIDOREDUCTASE
Deposited on 2013-02-04, released 2013-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.151
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c-555
    Species: Chlorobium tepidum [TaxId:194439]
    Gene: CT0075
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KG93 (0-87)
      • engineered mutation (0-1)
    Domains in SCOPe 2.05: d4j20a_
  • Chain 'B':
    Compound: Cytochrome c-555
    Species: Chlorobium tepidum [TaxId:194439]
    Gene: CT0075
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KG93 (0-87)
      • engineered mutation (0-1)
    Domains in SCOPe 2.05: d4j20b_
  • Heterogens: SO4, IPA, NA, HEB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j20A (A:)
    stydaaagkatydascatchktgmmgapkvgdkaawapriaqgmntlvsksikgykgtkg
    mmpakggnakltdaqvgnavaymvgqsk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j20B (B:)
    stydaaagkatydascatchktgmmgapkvgdkaawapriaqgmntlvsksikgykgtkg
    mmpakggnakltdaqvgnavaymvgqsk