PDB entry 4j20

View 4j20 on RCSB PDB site
Description: X-ray structure of the cytochrome c-554 from chlorobaculum tepidum
Class: oxidoreductase
Keywords: Cytocrome c, electron transfer, Cytochrome Cz, OXIDOREDUCTASE
Deposited on 2013-02-04, released 2013-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.151
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c-555
  Species: Chlorobium tepidum [TaxId:194439]
  Gene: CT0075
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8KG93 (0-87)
    • engineered mutation (0-1)
  Domains in SCOPe 2.08: d4j20a_
• Chain 'B':
  Compound: Cytochrome c-555
  Species: Chlorobium tepidum [TaxId:194439]
  Gene: CT0075
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8KG93 (0-87)
    • engineered mutation (0-1)
  Domains in SCOPe 2.08: d4j20b_
• Heterogens: SO4, IPA, NA, HEB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4j20A (A:)
  stydaaagkatydascatchktgmmgapkvgdkaawapriaqgmntlvsksikgykgtkg
  mmpakggnakltdaqvgnavaymvgqsk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4j20B (B:)
  stydaaagkatydascatchktgmmgapkvgdkaawapriaqgmntlvsksikgykgtkg
  mmpakggnakltdaqvgnavaymvgqsk