PDB entry 4j1u

View 4j1u on RCSB PDB site
Description: Crystal structure of antibody 93F3 unstable variant
Class: immune system
Keywords: antibody maturation, antibody stability, clonal selection, IMMUNE SYSTEM
Deposited on 2013-02-02, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.213
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody 93F3 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J1U (0-End)
    Domains in SCOPe 2.07: d4j1ua1, d4j1ua2
  • Chain 'B':
    Compound: antibody 93F3 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J1U (0-End)
  • Chain 'C':
    Compound: antibody 93F3 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J1U (0-End)
    Domains in SCOPe 2.07: d4j1uc1, d4j1uc2
  • Chain 'D':
    Compound: antibody 93F3 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J1U
  • Chain 'E':
    Compound: antibody 93F3 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J1U
    Domains in SCOPe 2.07: d4j1ue1, d4j1ue2
  • Chain 'F':
    Compound: antibody 93F3 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J1U
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j1uA (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqsptkliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsydlptfgagtklelkrsvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j1uA (A:)
    divmsqspsslavsagekvtmsckssqsllnknylawyqqkpgqsptkliywastresgv
    pdrftgsgsgtdftltissvqaedlavyyckqsydlptfgagtklelkrsvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksf
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4j1uC (C:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqsptkliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsydlptfgagtklelkrsvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j1uC (C:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqsptkliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsydlptfgagtklelkrsvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhacevthqglsspvtksfnr
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4j1uE (E:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqsptkliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsydlptfgagtklelkrsvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j1uE (E:)
    vmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqsptkliywastres
    gvpdrftgsgsgtdftltissvqaedlavyyckqsydlptfgagtklelkrsvaapsvfi
    fppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslss
    tltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'F':
    No sequence available.