PDB entry 4j1o

View 4j1o on RCSB PDB site
Description: Crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound l-proline betaine (substrate)
Class: isomerase
Keywords: Enolase, Betaine Racemase, Proline Betaine Racemease, NYSGRC, Structural Genomics, New York Structural Genomics Research Consortium, PSI-Biology, ISOMERASE
Deposited on 2013-02-01, released 2013-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.159
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
    Species: Paracoccus denitrificans [TaxId:318586]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j1oa1, d4j1oa2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
    Species: Paracoccus denitrificans [TaxId:318586]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j1ob1, d4j1ob2
  • Heterogens: MG, IOD, GOL, PBE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j1oA (A:)
    mhhhhhhssgvdlgtenlyfqsmkiaeihvyahdlpvkdgpytiasstvwslqttlvkiv
    adsglagwgetcpvgptyapshalgaraalaemapgliganplqplvlrrrmdgllcghn
    yakaaidiaaydlmgkhygvrvadllggvaaervpsyyatgigqpdeiariaaekvaegf
    prlqikiggrpveidietvrkvwerirgtgtrlavdgnrslpsrdalrlsrecpeipfvl
    eqpcntleeiaairgrvqhgiyldesgedlstviraagqglcdgfgmkltrigglqqmaa
    frdicearalphscddawggdiiaaacthigatvqprlnegvwvaqpyiaqpydeengir
    iagghidlpkgpglgitpdeslfgppvasfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j1oA (A:)
    mkiaeihvyahdlpvkdgpytiasstvwslqttlvkivadsglagwgetcpvgptyapsh
    algaraalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrv
    adllggvaaervpsyyatgigqpdeiariaaekvaegfprlqikiggrpveidietvrkv
    werirgtgtrlavdgnrslpsrdalrlsrecpeipfvleqpcntleeiaairgrvqhgiy
    ldesgedlstviraagqglcdgfgmkltrigglqqmaafrdicearalphscddawggdi
    iaaacthigatvqprlnegvwvaqpyiaqpydeengiriagghidlpkgpglgitpdesl
    fgppvasfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j1oB (B:)
    mhhhhhhssgvdlgtenlyfqsmkiaeihvyahdlpvkdgpytiasstvwslqttlvkiv
    adsglagwgetcpvgptyapshalgaraalaemapgliganplqplvlrrrmdgllcghn
    yakaaidiaaydlmgkhygvrvadllggvaaervpsyyatgigqpdeiariaaekvaegf
    prlqikiggrpveidietvrkvwerirgtgtrlavdgnrslpsrdalrlsrecpeipfvl
    eqpcntleeiaairgrvqhgiyldesgedlstviraagqglcdgfgmkltrigglqqmaa
    frdicearalphscddawggdiiaaacthigatvqprlnegvwvaqpyiaqpydeengir
    iagghidlpkgpglgitpdeslfgppvasfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j1oB (B:)
    mkiaeihvyahdlpvkdgpytiasstvwslqttlvkivadsglagwgetcpvgptyapsh
    algaraalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrv
    adllggvaaervpsyyatgigqpdeiariaaekvaegfprlqikiggrpveidietvrkv
    werirgtgtrlavdgnrslpsrdalrlsrecpeipfvleqpcntleeiaairgrvqhgiy
    ldesgedlstviraagqglcdgfgmkltrigglqqmaafrdicearalphscddawggdi
    iaaacthigatvqprlnegvwvaqpyiaqpydeengiriagghidlpkgpglgitpdesl
    fgppvasfs