PDB entry 4j1l

View 4j1l on RCSB PDB site
Description: Mutant Endotoxin TeNT
Class: Toxin
Keywords: Endotoxin, Toxin
Deposited on 2013-02-01, released 2014-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tetanus toxin
    Species: Clostridium tetani [TaxId:212717]
    Gene: tetX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04958 (0-425)
      • engineered mutation (166)
      • engineered mutation (228)
      • conflict (359)
    Domains in SCOPe 2.07: d4j1la_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j1lA (A:)
    pitinnfrysdpvnndtiimmeppyckgldiyykafkitdriwivperyefgtkpedfnp
    pssliegaseyydpnylrtdsdkdrflqtmvklfnriknnvagealldkiinaipylgns
    yslldkfdtnsnsvsfnlleqdpsgattksamltnliifgpgpvlnenevrgivlrvdnk
    nyfpcrdgfgsimqmafcpeyvptfdnvienitsltigkskyfqdpalilmhelihvlhg
    lygmqvssheiipskqeiymqhtypisaeelftfggqdanlisidikndlyektlndyka
    ianklsqvtscndpnididsykqiyqqkyqfdkdsngqyivnedkfqilynsimygftev
    elgkkfniktrlsyfsmnhdpvkipnllddtiyndtegfnieskdlkseykgqnmrvntn
    afrnvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j1lA (A:)
    pitinnfrysdpvnndtiimmeppyckgldiyykafkitdriwivperyefgtkpedfnp
    psseyydpnylrtdsdkdrflqtmvklfnriknnvagealldkiinaipylgnsyslldk
    fdtnsnsvsfnlleqdpsgattksamltnliifgpgpvlnenevrgivlrvdnknyfpcr
    dgfgsimqmafcpeyvptfdnskyfqdpalilmhelihvlhglygmqvsshsaeelftfg
    gqdanlisidikndlyektlndykaianklsqvtscndpnididsykqiyqqkyqfdkds
    ngqyivnedkfqilynsimygftevelgkkfniktrlsyfsmnhdpvkipnllddtiynd
    tegfnieskdlkseykgqnmrvntnafrnvd