PDB entry 4j12

View 4j12 on RCSB PDB site
Description: monomeric Fc
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2013-01-31, released 2013-05-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.223
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human Fc fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PYX1 (1-209)
      • engineered mutation (129)
      • engineered mutation (172)
      • engineered mutation (174)
    Domains in SCOPe 2.04: d4j12a1, d4j12a2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j12A (A:)
    nggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree
    qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlpps
    reemtknqvnltclvkgfypsdiavewesngqpennykttppvldsdgsfflnstltvdk
    srwqqgnvfscsvmhealhnhytqkslsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j12A (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    eemtknqvnltclvkgfypsdiavewesngqpennykttppvldsdgsfflnstltvdks
    rwqqgnvfscsvmhealhnhytqkslsls