PDB entry 4izg

View 4izg on RCSB PDB site
Description: Crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound cis-4oh-d-proline betaine (product)
Class: isomerase
Keywords: Enolase, Betaine Racemase, Proline Betaine Racemease, NYSGRC, Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, ISOMERASE
Deposited on 2013-01-29, released 2013-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
    Species: Paracoccus denitrificans [TaxId:318586]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4izga1, d4izga2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
    Species: Paracoccus denitrificans [TaxId:318586]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4izgb1, d4izgb2
  • Heterogens: IOD, MG, 4OP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4izgA (A:)
    mhhhhhhssgvdlgtenlyfqsmkiaeihvyahdlpvkdgpytiasstvwslqttlvkiv
    adsglagwgetcpvgptyapshalgaraalaemapgliganplqplvlrrrmdgllcghn
    yakaaidiaaydlmgkhygvrvadllggvaaervpsyyatgigqpdeiariaaekvaegf
    prlqikiggrpveidietvrkvwerirgtgtrlavdgnrslpsrdalrlsrecpeipfvl
    eqpcntleeiaairgrvqhgiyldesgedlstviraagqglcdgfgmkltrigglqqmaa
    frdicearalphscddawggdiiaaacthigatvqprlnegvwvaqpyiaqpydeengir
    iagghidlpkgpglgitpdeslfgppvasfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4izgA (A:)
    mkiaeihvyahdlpvkdgpytiasstvwslqttlvkivadsglagwgetcpvgptyapsh
    algaraalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrv
    adllggvaaervpsyyatgigqpdeiariaaekvaegfprlqikiggrpveidietvrkv
    werirgtgtrlavdgnrslpsrdalrlsrecpeipfvleqpcntleeiaairgrvqhgiy
    ldesgedlstviraagqglcdgfgmkltrigglqqmaafrdicearalphscddawggdi
    iaaacthigatvqprlnegvwvaqpyiaqpydeengiriagghidlpkgpglgitpdesl
    fgppvasfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4izgB (B:)
    mhhhhhhssgvdlgtenlyfqsmkiaeihvyahdlpvkdgpytiasstvwslqttlvkiv
    adsglagwgetcpvgptyapshalgaraalaemapgliganplqplvlrrrmdgllcghn
    yakaaidiaaydlmgkhygvrvadllggvaaervpsyyatgigqpdeiariaaekvaegf
    prlqikiggrpveidietvrkvwerirgtgtrlavdgnrslpsrdalrlsrecpeipfvl
    eqpcntleeiaairgrvqhgiyldesgedlstviraagqglcdgfgmkltrigglqqmaa
    frdicearalphscddawggdiiaaacthigatvqprlnegvwvaqpyiaqpydeengir
    iagghidlpkgpglgitpdeslfgppvasfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4izgB (B:)
    mkiaeihvyahdlpvkdgpytiasstvwslqttlvkivadsglagwgetcpvgptyapsh
    algaraalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrv
    adllggvaaervpsyyatgigqpdeiariaaekvaegfprlqikiggrpveidietvrkv
    werirgtgtrlavdgnrslpsrdalrlsrecpeipfvleqpcntleeiaairgrvqhgiy
    ldesgedlstviraagqglcdgfgmkltrigglqqmaafrdicearalphscddawggdi
    iaaacthigatvqprlnegvwvaqpyiaqpydeengiriagghidlpkgpglgitpdesl
    fgppvasfs