PDB entry 4iw3

View 4iw3 on RCSB PDB site
Description: Crystal structure of a Pseudomonas putida prolyl-4-hydroxylase (P4H) in complex with elongation factor Tu (EF-Tu)
Class: metal binding protein/translation
Keywords: 2-oxoglutarate oxygenase, oxygen sensing, protein synthesis regulation, double-stranded beta helix, jellyroll fold, prolyl-4-hydroxylase, translation, METAL BINDING PROTEIN-TRANSLATION complex
Deposited on 2013-01-23, released 2014-01-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.171
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_5159
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: elongation factor tu-a
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0440, tuf-1, tufA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4iw3b1, d4iw3b2, d4iw3b3
  • Chain 'J':
    Compound: Putative uncharacterized protein
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_5159
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: elongation factor tu-a
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0440, tuf-1, tufA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4iw3k1, d4iw3k2, d4iw3k3
  • Heterogens: MN, OGA, GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iw3B (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmakekfdrslphvnvgtighvdhg
    kttltaaltrvcsevfgsaivefdkidsapeekargitintahveynstirhyahvdcpg
    hadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvdda
    ellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyip
    epvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvem
    frklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrht
    pffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfairegg
    rtvgagvvakiie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iw3B (B:)
    lphvnvgtighvdhgkttltaaltrvcsevfgskidsapeekargitintahveynstir
    hyahvdcpghadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvfl
    nkadlvaellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklve
    tldsyipepvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttt
    tctgvemfrklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlsk
    eeggrhtpffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglr
    faireggrtvgagvvakiie
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4iw3K (K:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmakekfdrslphvnvgtighvdhg
    kttltaaltrvcsevfgsaivefdkidsapeekargitintahveynstirhyahvdcpg
    hadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvdda
    ellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyip
    epvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvem
    frklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrht
    pffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfairegg
    rtvgagvvakiie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iw3K (K:)
    lphvnvgtighvdhgkttltaaltrvcsevfgkidsapeekagitintahveynstirhy
    ahvdcpghadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnk
    adlvaellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetl
    dsyipepvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttc
    tgvemfrklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskee
    ggrhtpffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfa
    ireggrtvgagvvakiie