PDB entry 4iv6

View 4iv6 on RCSB PDB site
Description: X-ray crystal structure of an isovaleryl-CoA dehydrogenase from Mycobacterium smegmatis
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OXIDOREDUCTASE
Deposited on 2013-01-22, released 2013-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA dehydrogenase FadE3
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: fadE3, MSMEI_1947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4iv6a1, d4iv6a2
  • Chain 'B':
    Compound: Acyl-CoA dehydrogenase FadE3
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: fadE3, MSMEI_1947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4iv6b1, d4iv6b2
  • Heterogens: FDA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iv6A (A:)
    gpgsmaltaeeetivktvhdfvekqvkpvvrelehantypeelietmkeigifglaipep
    ygfgavsmpcyvqvaeelargwmslagamgghtvvskllllfgteeqkqkylprmatgel
    ratmaltepgggsdlqamrtvarrdgddyvingsktwisnarrsdlvalmcktdpdaqpa
    hkgvsillvekvpgfdvsrdlpklgykgvescelnftdarvpvssllgddegrgfaqmmk
    glevgrlqvaaratgvaraafedalrysqeresfgkpiwqhqsvgnmladmgtklyaars
    lllsaaekfdagqrcdmeagmaklfasetamqialdavrvhggygysteydveryfrdap
    lmivgegtneiqrnviakqlvarggldi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iv6A (A:)
    ltaeeetivktvhdfvekqvkpvvrelehantypeelietmkeigifglaipepygfgav
    smpcyvqvaeelargwmslagamgghtvvskllllfgteeqkqkylprmatgelratmal
    tepgggsdlqamrtvarrdgddyvingsktwisnarrsdlvalmcktdpdaqpahkgvsi
    llvekvpgfdvsrdlpklgykgvescelnftdarvpvssllgddegrgfaqmmkglevgr
    lqvaaratgvaraafedalrysqeresfgkpiwqhqsvgnmladmgtklyaarslllsaa
    ekfdagqrcdmeagmaklfasetamqialdavrvhggygysteydveryfrdaplmivge
    gtneiqrnviakqlvarggldi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iv6B (B:)
    gpgsmaltaeeetivktvhdfvekqvkpvvrelehantypeelietmkeigifglaipep
    ygfgavsmpcyvqvaeelargwmslagamgghtvvskllllfgteeqkqkylprmatgel
    ratmaltepgggsdlqamrtvarrdgddyvingsktwisnarrsdlvalmcktdpdaqpa
    hkgvsillvekvpgfdvsrdlpklgykgvescelnftdarvpvssllgddegrgfaqmmk
    glevgrlqvaaratgvaraafedalrysqeresfgkpiwqhqsvgnmladmgtklyaars
    lllsaaekfdagqrcdmeagmaklfasetamqialdavrvhggygysteydveryfrdap
    lmivgegtneiqrnviakqlvarggldi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iv6B (B:)
    altaeeetivktvhdfvekqvkpvvrelehantypeelietmkeigifglaipepygfga
    vsmpcyvqvaeelargwmslagamgghtvvskllllfgteeqkqkylprmatgelratma
    ltepgggsdlqamrtvarrdgddyvingsktwisnarrsdlvalmcktdpdaqpahkgvs
    illvekvpgfdvsrdlpklgykgvescelnftdarvpvssllgddegrgfaqmmkglevg
    rlqvaaratgvaraafedalrysqeresfgkpiwqhqsvgnmladmgtklyaarslllsa
    aekfdagqrcdmeagmaklfasetamqialdavrvhggygysteydveryfrdaplmivg
    egtneiqrnviakqlvarggldi