PDB entry 4iug

View 4iug on RCSB PDB site
Description: Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose
Class: hydrolase
Keywords: Tim Barrel, Glycoside hydrolase, HYDROLASE
Deposited on 2013-01-21, released 2013-07-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.182
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-galactosidase A
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: laca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4iuga1, d4iuga2, d4iuga3, d4iuga4, d4iuga5
  • Heterogens: CD, GAL, NAG, M6D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iugA (A:)
    mkllsvaavallaaqaagasikhrlngftilehpdpakrdllqdivtwddkslfingeri
    mlfsgevhpfrlpvpslwldifhkiralgfncvsfyidwallegkpgdyraegifalepf
    fdaakeagiyliarpgsyinaevsgggfpgwlqrvngtlrssdepflkatdnyianaaaa
    vakaqitnggpvilyqpeneysggccgvkypdadymqyvmdqarkadivvpfisndasps
    ghnapgsgtgavdiyghdsyplgfdcanpsvwpegklpdnfrtlhleqspstpysllefq
    agafdpwggpgfekcyalvnhefsrvfyrndlsfgvstfnlymtfggtnwgnlghpggyt
    sydygspitetrnvtrekysdikllanfvkaspsyltatprnlttgvytdtsdlavtpli
    gdspgsffvvrhtdyssqestsyklklptsagnltipqlegtlslngrdskihvvdynvs
    gtniiystaevftwkkfdgnkvlvlyggpkehhelaiasksnvtiiegsdsgivstrkgs
    sviigwdvsstrrivqvgdlrvflldrnsaynywvpelptegtspgfstskttassiivk
    agyllrgahldgadlhltadfnattpievigaptgaknlfvngekashtvdkngiwssev
    kyaapeiklpglkdldwkyldtlpeikssyddsawvsadlpktknthrpldtptslyssd
    ygfhtgyliyrghfvangkeseffirtqggsafgssvwlnetylgswtgadyamdgnsty
    klsqlesgknyvitvvidnlgldenwtvgeetmknprgilsyklsgqdasaitwkltgnl
    ggedyqdkvrgplnegglyaerqgfhqpqppseswesgspleglskpgigfytaqfdldl
    pkgwdvplyfnfgnntqaaraqlyvngyqygkftgnvgpqtsfpvpegilnyrgtnyval
    slwalesdgaklgsfelsyttpvltgygnvespeqpkyeqrkgay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iugA (A:)
    dllqdivtwddkslfingerimlfsgevhpfrlpvpslwldifhkiralgfncvsfyidw
    allegkpgdyraegifalepffdaakeagiyliarpgsyinaevsgggfpgwlqrvngtl
    rssdepflkatdnyianaaaavakaqitnggpvilyqpeneysdadymqyvmdqarkadi
    vvpfisndaspsghnapgsgtgavdiyghdsyplgfdcanpsvwpegklpdnfrtlhleq
    spstpysllefqagafdpwggpgfekcyalvnhefsrvfyrndlsfgvstfnlymtfggt
    nwgnlghpggytsydygspitetrnvtrekysdikllanfvkaspsyltatprnlttgvy
    tdtsdlavtpligdspgsffvvrhtdyssqestsyklklptsagnltipqlegtlslngr
    dskihvvdynvsgtniiystaevftwkkfdgnkvlvlyggpkehhelaiasksnvtiieg
    sdsgivstrkgssviigwdvsstrrivqvgdlrvflldrnsaynywvpelptegtspgfs
    tskttassiivkagyllrgahldgadlhltadfnattpievigaptgaknlfvngekash
    tvdkngiwssevkyaapeiklpglkdldwkyldtlpeikssyddsawvsadlpktknthr
    pldtptslyssdygfhtgyliyrghfvangkeseffirtqggsafgssvwlnetylgswt
    gadyamdgnstyklsqlesgknyvitvvidnlgldenwtvgeetmknprgilsyklsgqd
    asaitwkltgnlggedyqdkvrgplnegglyaerqgfhqpqppseswesgspleglskpg
    igfytaqfdldlpkgwdvplyfnfgnntqaaraqlyvngyqygkftgnvgpqtsfpvpeg
    ilnyrgtnyvalslwalesdgaklgsfelsyttpvltgygnvespeqpkyeqrkgay