PDB entry 4iuf

View 4iuf on RCSB PDB site
Description: Crystal Structure of Human TDP-43 RRM1 Domain in Complex with a Single-stranded DNA
Class: transcription regulator/DNA
Keywords: RNA Recognition Motif, RNA binding, DNA binding, splicing factor, TRANSCRIPTION REGULATOR-DNA complex, PROTEIN-DNA COMPLEX
Deposited on 2013-01-21, released 2014-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.212
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TAR DNA-binding protein 43
    Species: Homo sapiens [TaxId:9606]
    Gene: Tardbp, Tdp43
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4iufa_
  • Chain 'B':
    Compound: 5'-d(*gp*tp*tp*gp*(xua)p*gp*cp*gp*t)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4iufA (A:)
tsdlivlglpwktteqdlkeyfstfgevlmvqvkkdlktghskgfgfvrfteyetqvkvm
sqrhmidgrwcdcklpn

  • Chain 'B':
    No sequence available.