PDB entry 4itb

View 4itb on RCSB PDB site
Description: Structure of bacterial enzyme in complex with cofactor and substrate
Class: oxidoreductase/substrate
Keywords: Rossmann fold, OXIDOREDUCTASE, oxidoreductase-substrate complex
Deposited on 2013-01-18, released 2013-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.174
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate-semialdehyde dehydrogenase
    Species: Synechococcus sp. [TaxId:32049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4itba_
  • Chain 'B':
    Compound: Succinate-semialdehyde dehydrogenase
    Species: Synechococcus sp. [TaxId:32049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4itbb_
  • Heterogens: NDP, SSN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4itbA (A:)
    ghmaiatinpttgeicqrfkaltpaeidaklakaqeafqayrrtsfsqrrqwlenaaail
    erdtskfaeimttemgkthqsaiaeaeksalvcryyaehgeqflaneytetqatesyvcy
    qplgillavmpwnfpfwqvfrfaapalmagnvavlkhasnvpqcalaveaileaagfpeg
    vfqtlligasqveqvikdprvkaatltgsepagaslaslagqeikptllelggsdpfvvf
    psadldeavevgtvartmnngqsciaakrfilheaiaaefleklhlkfaslkigdpmape
    tdigplategilqdisrqvdqavaagakillggrpldragyfypptilteippgakilqe
    elfapvamvftvkdldqaialandipfglgasawtndpaeqqrfiqeldagavfingmvk
    sdprlpfggtkrsgygrelglagirtfvnaktvwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4itbA (A:)
    aiatinpttgeicqrfkaltpaeidaklakaqeafqayrrtsfsqrrqwlenaaailerd
    tskfaeimttemgkthqsaiaeaeksalvcryyaehgeqflaneytetqatesyvcyqpl
    gillavmpwnfpfwqvfrfaapalmagnvavlkhasnvpqcalaveaileaagfpegvfq
    tlligasqveqvikdprvkaatltgsepagaslaslagqeikptllelggsdpfvvfpsa
    dldeavevgtvartmnngqsciaakrfilheaiaaefleklhlkfaslkigdpmapetdi
    gplategilqdisrqvdqavaagakillggrpldragyfypptilteippgakilqeelf
    apvamvftvkdldqaialandipfglgasawtndpaeqqrfiqeldagavfingmvksdp
    rlpfggtkrsgygrelglagirtfvnaktvwlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4itbB (B:)
    ghmaiatinpttgeicqrfkaltpaeidaklakaqeafqayrrtsfsqrrqwlenaaail
    erdtskfaeimttemgkthqsaiaeaeksalvcryyaehgeqflaneytetqatesyvcy
    qplgillavmpwnfpfwqvfrfaapalmagnvavlkhasnvpqcalaveaileaagfpeg
    vfqtlligasqveqvikdprvkaatltgsepagaslaslagqeikptllelggsdpfvvf
    psadldeavevgtvartmnngqsciaakrfilheaiaaefleklhlkfaslkigdpmape
    tdigplategilqdisrqvdqavaagakillggrpldragyfypptilteippgakilqe
    elfapvamvftvkdldqaialandipfglgasawtndpaeqqrfiqeldagavfingmvk
    sdprlpfggtkrsgygrelglagirtfvnaktvwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4itbB (B:)
    aiatinpttgeicqrfkaltpaeidaklakaqeafqayrrtsfsqrrqwlenaaailerd
    tskfaeimttemgkthqsaiaeaeksalvcryyaehgeqflaneytetqatesyvcyqpl
    gillavmpwnfpfwqvfrfaapalmagnvavlkhasnvpqcalaveaileaagfpegvfq
    tlligasqveqvikdprvkaatltgsepagaslaslagqeikptllelggsdpfvvfpsa
    dldeavevgtvartmnngqsciaakrfilheaiaaefleklhlkfaslkigdpmapetdi
    gplategilqdisrqvdqavaagakillggrpldragyfypptilteippgakilqeelf
    apvamvftvkdldqaialandipfglgasawtndpaeqqrfiqeldagavfingmvksdp
    rlpfggtkrsgygrelglagirtfvnaktvwlk