PDB entry 4it9

View 4it9 on RCSB PDB site
Description: Structure of Bacterial Enzyme
Class: oxidoreductase
Keywords: Rossmann fold, OXIDOREDUCTASE
Deposited on 2013-01-18, released 2013-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate-semialdehyde dehydrogenase
    Species: Synechococcus sp. [TaxId:32049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4it9a_
  • Chain 'B':
    Compound: Succinate-semialdehyde dehydrogenase
    Species: Synechococcus sp. [TaxId:32049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4it9b_
  • Heterogens: EDO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4it9A (A:)
    ghmaiatinpttgeicqrfkaltpaeidaklakaqeafqayrrtsfsqrrqwlenaaail
    erdtskfaeimttemgkthqsaiaeaeksalvcryyaehgeqflaneytetqatesyvcy
    qplgillavmpwnfpfwqvfrfaapalmagnvavlkhasnvpqcalaveaileaagfpeg
    vfqtlligasqveqvikdprvkaatltgsepagaslaslagqeikptllelggsdpfvvf
    psadldeavevgtvartmnngqsciaakrfilheaiaaefleklhlkfaslkigdpmape
    tdigplategilqdisrqvdqavaagakillggrpldragyfypptilteippgakilqe
    elfapvamvftvkdldqaialandipfglgasawtndpaeqqrfiqeldagavfingmvk
    sdprlpfggtkrsgygrelglagirtfvnaktvwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4it9A (A:)
    iatinpttgeicqrfkaltpaeidaklakaqeafqayrrtsfsqrrqwlenaaailerdt
    skfaeimttemgkthqsaiaeaeksalvcryyaehgeqflaneytetqatesyvcyqplg
    illavmpwnfpfwqvfrfaapalmagnvavlkhasnvpqcalaveaileaagfpegvfqt
    lligasqveqvikdprvkaatltgsepagaslaslagqeikptllelggsdpfvvfpsad
    ldeavevgtvartmnngqsciaakrfilheaiaaefleklhlkfaslkigdpmapetdig
    plategilqdisrqvdqavaagakillggrpldragyfypptilteippgakilqeelfa
    pvamvftvkdldqaialandipfglgasawtndpaeqqrfiqeldagavfingmvksdpr
    lpfggtkrsgygrelglagirtfvnaktvwlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4it9B (B:)
    ghmaiatinpttgeicqrfkaltpaeidaklakaqeafqayrrtsfsqrrqwlenaaail
    erdtskfaeimttemgkthqsaiaeaeksalvcryyaehgeqflaneytetqatesyvcy
    qplgillavmpwnfpfwqvfrfaapalmagnvavlkhasnvpqcalaveaileaagfpeg
    vfqtlligasqveqvikdprvkaatltgsepagaslaslagqeikptllelggsdpfvvf
    psadldeavevgtvartmnngqsciaakrfilheaiaaefleklhlkfaslkigdpmape
    tdigplategilqdisrqvdqavaagakillggrpldragyfypptilteippgakilqe
    elfapvamvftvkdldqaialandipfglgasawtndpaeqqrfiqeldagavfingmvk
    sdprlpfggtkrsgygrelglagirtfvnaktvwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4it9B (B:)
    iatinpttgeicqrfkaltpaeidaklakaqeafqayrrtsfsqrrqwlenaaailerdt
    skfaeimttemgkthqsaiaeaeksalvcryyaehgeqflaneytetqatesyvcyqplg
    illavmpwnfpfwqvfrfaapalmagnvavlkhasnvpqcalaveaileaagfpegvfqt
    lligasqveqvikdprvkaatltgsepagaslaslagqeikptllelggsdpfvvfpsad
    ldeavevgtvartmnngqsciaakrfilheaiaaefleklhlkfaslkigdpmapetdig
    plategilqdisrqvdqavaagakillggrpldragyfypptilteippgakilqeelfa
    pvamvftvkdldqaialandipfglgasawtndpaeqqrfiqeldagavfingmvksdpr
    lpfggtkrsgygrelglagirtfvnaktvwlk