PDB entry 4it1

View 4it1 on RCSB PDB site
Description: Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
Class: isomerase
Keywords: isomerase, dehydrogenase, magnesium binding nadp, structural genomics, enzyme function initiative, efi
Deposited on 2013-01-17, released 2013-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative glucarate dehydratase
    Species: Pseudomonas fluorescens [TaxId:205922]
    Gene: Pfl01_3283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3KB33 (22-445)
      • expression tag (20-21)
    Domains in SCOPe 2.06: d4it1a1, d4it1a2, d4it1a3
  • Chain 'B':
    Compound: Putative glucarate dehydratase
    Species: Pseudomonas fluorescens [TaxId:205922]
    Gene: Pfl01_3283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3KB33 (22-445)
      • expression tag (21)
    Domains in SCOPe 2.06: d4it1b1, d4it1b2, d4it1b3
  • Chain 'C':
    Compound: Putative glucarate dehydratase
    Species: Pseudomonas fluorescens [TaxId:205922]
    Gene: Pfl01_3283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3KB33 (22-445)
      • expression tag (20-21)
    Domains in SCOPe 2.06: d4it1c1, d4it1c2, d4it1c3
  • Chain 'D':
    Compound: Putative glucarate dehydratase
    Species: Pseudomonas fluorescens [TaxId:205922]
    Gene: Pfl01_3283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3KB33 (22-445)
      • expression tag (19-21)
    Domains in SCOPe 2.06: d4it1d1, d4it1d2, d4it1d3
  • Heterogens: MG, TLA, K, BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4it1A (A:)
    mhhhhhhssgvdlgtenlyfqsmkitrvtvtpiafrdppllnasgihepfalrsiieies
    dngyiglgesygdapalaiqqqvqsqligldpfnlnqlrrivqttvaahkpaslagaela
    pgshaskavsnaysafevafldlqarylnvplvdllggavrdevpfsaylffkyaqhvds
    pykpdnwgealneqqivaqaarmieaygfksiklkagtlppehevacikalkkafpgypl
    ridpngnwsletsirmaellgddlqyyedptpglegmaelhkrtglplatnmvvtdfdef
    rrsvaqnsvqivladhhywgglrdtqtlakmcdtfglgvsmhsnshlgislmamahvaaa
    vpnldyacdthypwqepdeevikggklpivdgcvkitrapglgleldhdqlgklhdqylt
    cgirqrddvrqmqrykpdwkalkprf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4it1A (A:)
    qsmkitrvtvtpiafrdppllnasgihepfalrsiieiesdngyiglgesygdapalaiq
    qqvqsqligldpfnlnqlrrivqttvaahkpaslagaelapgshaskavsnaysafevaf
    ldlqarylnvplvdllggavrdevpfsaylffkyaqhvdspykpdnwgealneqqivaqa
    armieaygfksiklkagtlppehevacikalkkafpgyplridpngnwsletsirmaell
    gddlqyyedptpglegmaelhkrtglplatnmvvtdfdefrrsvaqnsvqivladhhywg
    glrdtqtlakmcdtfglgvsmhsnshlgislmamahvaaavpnldyacdthypwqepdee
    vikggklpivdgcvkitrapglgleldhdqlgklhdqyltcgirqrddvrqmqrykpdwk
    alkprf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4it1B (B:)
    mhhhhhhssgvdlgtenlyfqsmkitrvtvtpiafrdppllnasgihepfalrsiieies
    dngyiglgesygdapalaiqqqvqsqligldpfnlnqlrrivqttvaahkpaslagaela
    pgshaskavsnaysafevafldlqarylnvplvdllggavrdevpfsaylffkyaqhvds
    pykpdnwgealneqqivaqaarmieaygfksiklkagtlppehevacikalkkafpgypl
    ridpngnwsletsirmaellgddlqyyedptpglegmaelhkrtglplatnmvvtdfdef
    rrsvaqnsvqivladhhywgglrdtqtlakmcdtfglgvsmhsnshlgislmamahvaaa
    vpnldyacdthypwqepdeevikggklpivdgcvkitrapglgleldhdqlgklhdqylt
    cgirqrddvrqmqrykpdwkalkprf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4it1B (B:)
    smkitrvtvtpiafrdppllnasgihepfalrsiieiesdngyiglgesygdapalaiqq
    qvqsqligldpfnlnqlrrivqttvaahkpaslagaelapgshaskavsnaysafevafl
    dlqarylnvplvdllggavrdevpfsaylffkyaqhvdspykpdnwgealneqqivaqaa
    rmieaygfksiklkagtlppehevacikalkkafpgyplridpngnwsletsirmaellg
    ddlqyyedptpglegmaelhkrtglplatnmvvtdfdefrrsvaqnsvqivladhhywgg
    lrdtqtlakmcdtfglgvsmhsnshlgislmamahvaaavpnldyacdthypwqepdeev
    ikggklpivdgcvkitrapglgleldhdqlgklhdqyltcgirqrddvrqmqrykpdwka
    lkprf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4it1C (C:)
    mhhhhhhssgvdlgtenlyfqsmkitrvtvtpiafrdppllnasgihepfalrsiieies
    dngyiglgesygdapalaiqqqvqsqligldpfnlnqlrrivqttvaahkpaslagaela
    pgshaskavsnaysafevafldlqarylnvplvdllggavrdevpfsaylffkyaqhvds
    pykpdnwgealneqqivaqaarmieaygfksiklkagtlppehevacikalkkafpgypl
    ridpngnwsletsirmaellgddlqyyedptpglegmaelhkrtglplatnmvvtdfdef
    rrsvaqnsvqivladhhywgglrdtqtlakmcdtfglgvsmhsnshlgislmamahvaaa
    vpnldyacdthypwqepdeevikggklpivdgcvkitrapglgleldhdqlgklhdqylt
    cgirqrddvrqmqrykpdwkalkprf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4it1C (C:)
    qsmkitrvtvtpiafrdppllnasgihepfalrsiieiesdngyiglgesygdapalaiq
    qqvqsqligldpfnlnqlrrivqttvaahkpaslagaelapgshaskavsnaysafevaf
    ldlqarylnvplvdllggavrdevpfsaylffkyaqhvdspykpdnwgealneqqivaqa
    armieaygfksiklkagtlppehevacikalkkafpgyplridpngnwsletsirmaell
    gddlqyyedptpglegmaelhkrtglplatnmvvtdfdefrrsvaqnsvqivladhhywg
    glrdtqtlakmcdtfglgvsmhsnshlgislmamahvaaavpnldyacdthypwqepdee
    vikggklpivdgcvkitrapglgleldhdqlgklhdqyltcgirqrddvrqmqrykpdwk
    alkprf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4it1D (D:)
    mhhhhhhssgvdlgtenlyfqsmkitrvtvtpiafrdppllnasgihepfalrsiieies
    dngyiglgesygdapalaiqqqvqsqligldpfnlnqlrrivqttvaahkpaslagaela
    pgshaskavsnaysafevafldlqarylnvplvdllggavrdevpfsaylffkyaqhvds
    pykpdnwgealneqqivaqaarmieaygfksiklkagtlppehevacikalkkafpgypl
    ridpngnwsletsirmaellgddlqyyedptpglegmaelhkrtglplatnmvvtdfdef
    rrsvaqnsvqivladhhywgglrdtqtlakmcdtfglgvsmhsnshlgislmamahvaaa
    vpnldyacdthypwqepdeevikggklpivdgcvkitrapglgleldhdqlgklhdqylt
    cgirqrddvrqmqrykpdwkalkprf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4it1D (D:)
    fqsmkitrvtvtpiafrdppllnasgihepfalrsiieiesdngyiglgesygdapalai
    qqqvqsqligldpfnlnqlrrivqttvaahkpaslagaelapgshaskavsnaysafeva
    fldlqarylnvplvdllggavrdevpfsaylffkyaqhvdspykpdnwgealneqqivaq
    aarmieaygfksiklkagtlppehevacikalkkafpgyplridpngnwsletsirmael
    lgddlqyyedptpglegmaelhkrtglplatnmvvtdfdefrrsvaqnsvqivladhhyw
    gglrdtqtlakmcdtfglgvsmhsnshlgislmamahvaaavpnldyacdthypwqepde
    evikggklpivdgcvkitrapglgleldhdqlgklhdqyltcgirqrddvrqmqrykpdw
    kalkprf