PDB entry 4isv

View 4isv on RCSB PDB site
Description: Crystal structure of the Fab FRAGMENT OF 1C2, A MONOCLONAL ANTIBODY SPECIFIC FOR POLY-GLUTAMINE
Class: immune system
Keywords: 1C2,Fab, Vlx, Neurodegeneration, Polyglutamine Disease, Amyloid Disease, Immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2013-01-17, released 2013-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.199
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1c2 fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ISV (0-216)
    Domains in SCOPe 2.06: d4isva1, d4isva2
  • Chain 'B':
    Compound: 1c2 fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ISV (0-220)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4isvA (A:)
    qlvltqsssasfslgasakltctlsrqhstytiewyqqqplkppkfvmelkkdgshstgd
    gipdrfsgsssgahrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgqpks
    tptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkegnkf
    massflhltsdqwrshnsftcqvthegdtvekslspa
    

  • Chain 'B':
    No sequence available.