PDB entry 4isl

View 4isl on RCSB PDB site
Description: Crystal Structure of the inactive Matriptase in complex with its inhibitor HAI-1
Class: hydrolase/hydrolase inhibitor
Keywords: Beta barrel, Serine protease inhibitor, epithelium, hydrolase-hydrolase inhibitor complex
Deposited on 2013-01-16, released 2013-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Suppressor of tumorigenicity 14 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: PRSS14, SNC19, ST14, TADG15
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y5Y6 (0-240)
    • engineered mutation (157)
    • engineered mutation (190)
  Domains in SCOPe 2.06: d4isla_
• Chain 'B':
  Compound: Kunitz-type protease inhibitor 1
  Species: Homo sapiens [TaxId:9606]
  Gene: HAI1, SPINT1, UNQ223/PRO256
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43278 (0-59)
  Domains in SCOPe 2.06: d4islb_
• Heterogens: PG4, GOL, PGE, GSH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4islA (A:)
  vvggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyiddrgfrysdptqwta
  flglhdqsqrsapgvqerrlkriishpffndftfdydiallelekpaeyssmvrpiclpd
  ashvfpagkaiwvtgwghtqyggtgalilqkgeirviqqttcenllpqqitprmmcvgfl
  sggvdscqgdaggplssveadgrifqagvvswgdgcaqrnkpgvytrlplfrdwikentg
  v
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4islB (B:)
  qtedyclasnkvgrcrgsfprwyydpteqicksfvyggclgnknnylreeecilacrgvq