PDB entry 4is8

View 4is8 on RCSB PDB site
Description: Divergent sequence tunes ligand sensitivity in phospholipid-regulated hormone receptors
Class: transcription
Keywords: ligand binding domain, transcription
Deposited on 2013-01-16, released 2013-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.225
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 5 group A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: B1F, CPF, FTF, NR5A2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00482 (0-238)
      • engineered mutation (119-124)
    Domains in SCOPe 2.06: d4is8a_
  • Chain 'B':
    Compound: Nuclear receptor subfamily 5 group A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: B1F, CPF, FTF, NR5A2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00482 (0-238)
      • engineered mutation (119-124)
    Domains in SCOPe 2.06: d4is8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4is8A (A:)
    siphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsivew
    arssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiash
    tevafnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvna
    alldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4is8A (A:)
    siphlilellkcepdepqvqakimaylqqeqaklstfglmckmadqtlfsivewarssif
    frelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiashtevafn
    nlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvnaalldyt
    mcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvplliemlha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4is8B (B:)
    siphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsivew
    arssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiash
    tevafnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvna
    alldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4is8B (B:)
    siphlilellkcepdepqvqakimaylqqeqaklstfglmckmadqtlfsivewarssif
    frelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiashtevafn
    nlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvnaalldyt
    mcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvplliemlha