PDB entry 4is5

View 4is5 on RCSB PDB site
Description: Crystal Structure of the ligand-free inactive Matriptase
Class: hydrolase
Keywords: Beta barrel, Serine protease, epithelium, hydrolase
Deposited on 2013-01-16, released 2013-03-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.16
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Suppressor of tumorigenicity 14 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS14, SNC19, ST14, TADG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5Y6 (0-240)
      • engineered mutation (157)
      • engineered mutation (190)
    Domains in SCOPe 2.03: d4is5a_
  • Heterogens: SO4, GOL, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4is5A (A:)
vvggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyiddrgfrysdptqwta
flglhdqsqrsapgvqerrlkriishpffndftfdydiallelekpaeyssmvrpiclpd
ashvfpagkaiwvtgwghtqyggtgalilqkgeirviqqttcenllpqqitprmmcvgfl
sggvdscqgdaggplssveadgrifqagvvswgdgcaqrnkpgvytrlplfrdwikentg
v