PDB entry 4irn

View 4irn on RCSB PDB site
Description: Crystal Structure of the Prolyl Acyl Carrier Protein Oxidase AnaB
Class: oxidoreductase
Keywords: Acyl CoA Dehydrogenase fold, Acyl-ACP Oxidase, OXIDOREDUCTASE
Deposited on 2013-01-15, released 2013-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.189
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4irna1, d4irna2
  • Chain 'B':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4irnb1, d4irnb2
  • Chain 'C':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4irnc1, d4irnc2
  • Chain 'D':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4irnd1, d4irnd2
  • Chain 'E':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4irne1, d4irne2
  • Chain 'F':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4irnf1, d4irnf2
  • Chain 'G':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4irng1, d4irng2
  • Chain 'H':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4irnh1, d4irnh2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4irnA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefdfawnsqqiqfrkkviqfaqqsli
    sdlikndkeeifnrdawqkcsefgvhgwpiparyggqeldilttayalqglgygckdngl
    ifamnahiwacemplltfgteeqkekylpllcrggwiashaatepqagsdiyslkttaqk
    dgdkyilngykhyvtngtiadlfiifatidpslgkeglttfmiekdtpglilskpiskmg
    mrtaevpelrlencevsaanrlgeegtglaifnhsmewergfilaaavgtmerlleqsir
    yarshkqfgqaigkfqlvanklvemklrlenakaylykvawmkenkqmalleasmanlyi
    seawvqscleaieihgaygyltntelerelrdaiaskfysgtseiqrvviakflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4irnA (A:)
    awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
    ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
    shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
    ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgeegtglaifnhsmew
    ergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvemklrlenakaylyk
    vawmkenkqmalleasmanlyiseawvqscleaieihgaygyltntelerelrdaiaskf
    ysgtseiqrvviakflgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4irnB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefdfawnsqqiqfrkkviqfaqqsli
    sdlikndkeeifnrdawqkcsefgvhgwpiparyggqeldilttayalqglgygckdngl
    ifamnahiwacemplltfgteeqkekylpllcrggwiashaatepqagsdiyslkttaqk
    dgdkyilngykhyvtngtiadlfiifatidpslgkeglttfmiekdtpglilskpiskmg
    mrtaevpelrlencevsaanrlgeegtglaifnhsmewergfilaaavgtmerlleqsir
    yarshkqfgqaigkfqlvanklvemklrlenakaylykvawmkenkqmalleasmanlyi
    seawvqscleaieihgaygyltntelerelrdaiaskfysgtseiqrvviakflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4irnB (B:)
    awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
    ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
    shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
    ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgeegtglaifnhsmew
    ergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvemklrlenakaylyk
    vawmkenkqmalleasmanlyiseawvqscleaieihgaygyltntelerelrdaiaskf
    ysgtseiqrvviakflgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4irnC (C:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefdfawnsqqiqfrkkviqfaqqsli
    sdlikndkeeifnrdawqkcsefgvhgwpiparyggqeldilttayalqglgygckdngl
    ifamnahiwacemplltfgteeqkekylpllcrggwiashaatepqagsdiyslkttaqk
    dgdkyilngykhyvtngtiadlfiifatidpslgkeglttfmiekdtpglilskpiskmg
    mrtaevpelrlencevsaanrlgeegtglaifnhsmewergfilaaavgtmerlleqsir
    yarshkqfgqaigkfqlvanklvemklrlenakaylykvawmkenkqmalleasmanlyi
    seawvqscleaieihgaygyltntelerelrdaiaskfysgtseiqrvviakflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4irnC (C:)
    awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
    ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
    shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
    ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgeegtglaifnhsmew
    ergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvemklrlenakaylyk
    vawmkenkqmalleasmanlyiseawvqscleaieihgaygyltntelerelrdaiaskf
    ysgtseiqrvviakflgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4irnD (D:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefdfawnsqqiqfrkkviqfaqqsli
    sdlikndkeeifnrdawqkcsefgvhgwpiparyggqeldilttayalqglgygckdngl
    ifamnahiwacemplltfgteeqkekylpllcrggwiashaatepqagsdiyslkttaqk
    dgdkyilngykhyvtngtiadlfiifatidpslgkeglttfmiekdtpglilskpiskmg
    mrtaevpelrlencevsaanrlgeegtglaifnhsmewergfilaaavgtmerlleqsir
    yarshkqfgqaigkfqlvanklvemklrlenakaylykvawmkenkqmalleasmanlyi
    seawvqscleaieihgaygyltntelerelrdaiaskfysgtseiqrvviakflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4irnD (D:)
    awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
    ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
    shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
    ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgeegtglaifnhsmew
    ergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvemklrlenakaylyk
    vawmkenkqmalleasmanlyiseawvqscleaieihgaygyltntelerelrdaiaskf
    ysgtseiqrvviakflgl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4irnE (E:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefdfawnsqqiqfrkkviqfaqqsli
    sdlikndkeeifnrdawqkcsefgvhgwpiparyggqeldilttayalqglgygckdngl
    ifamnahiwacemplltfgteeqkekylpllcrggwiashaatepqagsdiyslkttaqk
    dgdkyilngykhyvtngtiadlfiifatidpslgkeglttfmiekdtpglilskpiskmg
    mrtaevpelrlencevsaanrlgeegtglaifnhsmewergfilaaavgtmerlleqsir
    yarshkqfgqaigkfqlvanklvemklrlenakaylykvawmkenkqmalleasmanlyi
    seawvqscleaieihgaygyltntelerelrdaiaskfysgtseiqrvviakflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4irnE (E:)
    awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
    ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
    shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
    ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgeegtglaifnhsmew
    ergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvemklrlenakaylyk
    vawmkenkqmalleasmanlyiseawvqscleaieihgaygyltntelerelrdaiaskf
    ysgtseiqrvviakflgl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4irnF (F:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefdfawnsqqiqfrkkviqfaqqsli
    sdlikndkeeifnrdawqkcsefgvhgwpiparyggqeldilttayalqglgygckdngl
    ifamnahiwacemplltfgteeqkekylpllcrggwiashaatepqagsdiyslkttaqk
    dgdkyilngykhyvtngtiadlfiifatidpslgkeglttfmiekdtpglilskpiskmg
    mrtaevpelrlencevsaanrlgeegtglaifnhsmewergfilaaavgtmerlleqsir
    yarshkqfgqaigkfqlvanklvemklrlenakaylykvawmkenkqmalleasmanlyi
    seawvqscleaieihgaygyltntelerelrdaiaskfysgtseiqrvviakflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4irnF (F:)
    awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
    ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
    shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
    ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgeegtglaifnhsmew
    ergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvemklrlenakaylyk
    vawmkenkqmalleasmanlyiseawvqscleaieihgaygyltntelerelrdaiaskf
    ysgtseiqrvviakflgl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4irnG (G:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefdfawnsqqiqfrkkviqfaqqsli
    sdlikndkeeifnrdawqkcsefgvhgwpiparyggqeldilttayalqglgygckdngl
    ifamnahiwacemplltfgteeqkekylpllcrggwiashaatepqagsdiyslkttaqk
    dgdkyilngykhyvtngtiadlfiifatidpslgkeglttfmiekdtpglilskpiskmg
    mrtaevpelrlencevsaanrlgeegtglaifnhsmewergfilaaavgtmerlleqsir
    yarshkqfgqaigkfqlvanklvemklrlenakaylykvawmkenkqmalleasmanlyi
    seawvqscleaieihgaygyltntelerelrdaiaskfysgtseiqrvviakflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4irnG (G:)
    awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
    ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
    shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
    ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgeegtglaifnhsmew
    ergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvemklrlenakaylyk
    vawmkenkqmalleasmanlyiseawvqscleaieihgaygyltntelerelrdaiaskf
    ysgtseiqrvviakflgl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4irnH (H:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefdfawnsqqiqfrkkviqfaqqsli
    sdlikndkeeifnrdawqkcsefgvhgwpiparyggqeldilttayalqglgygckdngl
    ifamnahiwacemplltfgteeqkekylpllcrggwiashaatepqagsdiyslkttaqk
    dgdkyilngykhyvtngtiadlfiifatidpslgkeglttfmiekdtpglilskpiskmg
    mrtaevpelrlencevsaanrlgeegtglaifnhsmewergfilaaavgtmerlleqsir
    yarshkqfgqaigkfqlvanklvemklrlenakaylykvawmkenkqmalleasmanlyi
    seawvqscleaieihgaygyltntelerelrdaiaskfysgtseiqrvviakflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4irnH (H:)
    awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
    ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
    shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
    ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgeegtglaifnhsmew
    ergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvemklrlenakaylyk
    vawmkenkqmalleasmanlyiseawvqscleaieihgaygyltntelerelrdaiaskf
    ysgtseiqrvviakflgl