PDB entry 4irn

View 4irn on RCSB PDB site
Description: Crystal Structure of the Prolyl Acyl Carrier Protein Oxidase AnaB
Class: oxidoreductase
Keywords: Acyl CoA Dehydrogenase fold, Acyl-ACP Oxidase, OXIDOREDUCTASE
Deposited on 2013-01-15, released 2013-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.189
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4irnf1, d4irnf2
  • Chain 'G':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Prolyl-ACP dehydrogenase
    Species: Oscillatoria sp. [TaxId:272129]
    Gene: anaB, OSCI_4070008
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4irnF (F:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefdfawnsqqiqfrkkviqfaqqsli
    sdlikndkeeifnrdawqkcsefgvhgwpiparyggqeldilttayalqglgygckdngl
    ifamnahiwacemplltfgteeqkekylpllcrggwiashaatepqagsdiyslkttaqk
    dgdkyilngykhyvtngtiadlfiifatidpslgkeglttfmiekdtpglilskpiskmg
    mrtaevpelrlencevsaanrlgeegtglaifnhsmewergfilaaavgtmerlleqsir
    yarshkqfgqaigkfqlvanklvemklrlenakaylykvawmkenkqmalleasmanlyi
    seawvqscleaieihgaygyltntelerelrdaiaskfysgtseiqrvviakflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4irnF (F:)
    awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
    ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
    shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
    ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgeegtglaifnhsmew
    ergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvemklrlenakaylyk
    vawmkenkqmalleasmanlyiseawvqscleaieihgaygyltntelerelrdaiaskf
    ysgtseiqrvviakflgl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.