PDB entry 4irg

View 4irg on RCSB PDB site
Description: Uninhibited DNA-binding domain of the Ets transcription factor ERG
Class: DNA binding protein
Keywords: winged Helix-Turn-Helix, Ets domain, DNA BINDING PROTEIN
Deposited on 2013-01-14, released 2013-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator ERG
    Species: Homo sapiens [TaxId:9606]
    Gene: ERG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11308 (9-End)
      • expression tag (6-8)
    Domains in SCOPe 2.06: d4irga1, d4irga2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4irgA (A:)
    gamgsgiqrpgsgqiqlwqfllellsdssnsscitwegtngefkmtdpdevarrwgerks
    kpnmnydklsralryyydknimtkvhgkryaykfdfhgiaqalqphppe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4irgA (A:)
    iqrpgsgqiqlwqfllellsdssnsscitwegtngefkmtdpdevarrwgerkskpnmny
    dklsralryyydknimtkvhgkryaykfdfhgiaqalq