PDB entry 4iqp

View 4iqp on RCSB PDB site
Description: Crystal Structure of HCRA-W1266A
Class: toxin
Keywords: Botulinum Neurotoxin, receptor binding domain, Ganglioside binding loop, TOXIN
Deposited on 2013-01-12, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: atx, bna, botA, Botulinum neurotoxin type A receptor binding domain
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10845 (Start-425)
      • engineered mutation (395)
    Domains in SCOPe 2.07: d4iqpa1, d4iqpa2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iqpA (A:)
    kniintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilkn
    aivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdt
    qeikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihas
    nnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqydkp
    yymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgtkfiikkyasgnk
    dnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskndqg
    itnkckmnlqdnngndigfigfhqfnniaklvasnaynrqierssrtlgcswefipvddg
    wgerpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iqpA (A:)
    tsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyn
    smyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikq
    rvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimf
    kldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqydkpyymln
    lydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgtkfiikkyasgnkdnivr
    nndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmksknqgitnkck
    mnlqdnngndigfigfhqfnniaklvasnaynrqirssrtlgcswefipvddgwgerpl